Scaffold Ga0115888_119727

Overview

Basic Information

• Taxon OID: 3300008807
• Scaffold ID: Ga0115888_119727
• Source Dataset Name: Wastewater viral communities from SBR reactor in SCELSE, Singapore - ContigAbv1k
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2523
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Sbr_Wastewater → Role Of Bacteriophages In Aerobic Granulation

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.345254
  • Long. (^o): 103.678179

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058147	Metagenome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115888_1197274	F058147	N/A	MNRKSIIVFIKGDRVETYGNLKKCCEFENLKYHTLARLKFPIRINDVVIHKTPFK*