NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115888_116944

Scaffold Ga0115888_116944


Overview

Basic Information
Taxon OID3300008807 Open in IMG/M
Scaffold IDGa0115888_116944 Open in IMG/M
Source Dataset NameWastewater viral communities from SBR reactor in SCELSE, Singapore - ContigAbv1k
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8059
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Sbr_Wastewater → Role Of Bacteriophages In Aerobic Granulation

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.345254Long. (o)103.678179Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078200Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0115888_1169446F078200AGGMAVYANSSNQVAALKELYKDDSWVMKDLVYKQNPLLALLPKDESPSGMAGK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.