Scaffold Ga0115888_103142

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115888_103142

Scaffold Ga0115888_103142

Overview

Basic Information
Taxon OID	3300008807 Open in IMG/M
Scaffold ID	Ga0115888_103142 Open in IMG/M
Source Dataset Name	Wastewater viral communities from SBR reactor in SCELSE, Singapore - ContigAbv1k
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1235
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Sbr_Wastewater → Role Of Bacteriophages In Aerobic Granulation

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.345254	Long. (^o)	103.678179	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004519	Metagenome / Metatranscriptome	434	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115888_1031422	F004519	N/A	MATFRKYAFPKQKDADKVLALCTGTTAAVDLGIIDSLICYDILWESDAPAIATQFETWPTPCGVHSFLGWDEQYTEDYNQHQSL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.