| Basic Information | |
|---|---|
| Taxon OID | 3300008807 Open in IMG/M |
| Scaffold ID | Ga0115888_100659 Open in IMG/M |
| Source Dataset Name | Wastewater viral communities from SBR reactor in SCELSE, Singapore - ContigAbv1k |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1206 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Sbr_Wastewater → Role Of Bacteriophages In Aerobic Granulation |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.345254 | Long. (o) | 103.678179 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000388 | Metagenome / Metatranscriptome | 1201 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115888_1006592 | F000388 | AGGAG | MKVIKVTKEYFQTEDEKVYFFEPLEKEISIEDMQKIVDANEKLVKELKTDDCIKPV* |
| ⦗Top⦘ |