Scaffold Ga0103765_1023390

Overview

Basic Information

• Taxon OID: 3300008798
• Scaffold ID: Ga0103765_1023390
• Source Dataset Name: Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample KO-3
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Duisburg-Essen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 514
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond → Planktonic Communities From Eutrophic Pond At The Campus Essen Of The University Duisburg-essen, Germany

Source Dataset Sampling Location

• Location Name: University Duisburg-Essen, Germany
• Coordinates
  • Lat. (^o): 51.46
  • Long. (^o): 7.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039474	Metatranscriptome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103765_10233901	F039474	N/A	QAFGYGDPCPPGAPGFGGEHQQAPPETVQNTVRYISENMTNPPKYKEIIEGFGYPGMKHSLAGGLLTIGRIYYGPGRYDYGRPKMPKGWIANFFYPAWEFLHILFVTDRYIMWRLIRNVGATLLCWIPLDMYYEYNKAYKKEYKAKYGSI*