Basic Information | |
---|---|
Taxon OID | 3300008794 Open in IMG/M |
Scaffold ID | Ga0103700_102151 Open in IMG/M |
Source Dataset Name | Microbial communities from freshwater in the western basin of Lake Erie, USA - 882-1 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 536 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | western basin of Lake Erie, USA | |||||||
Coordinates | Lat. (o) | 41.76 | Long. (o) | -83.31 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007520 | Metagenome / Metatranscriptome | 349 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103700_1021511 | F007520 | N/A | PGPWDAFGVTALSIGRSRNKTERLVLYNVNVPVHLISNENVYNVIRDTIVHDFDNNSGIYFQLSAVYTLVNRDTGDLRTWTGSFNPRNRQPSQLSTHRRFEADTFIDFARANSSIEVVLQKLTANYATAGQTSVWSLQDLKSIIFSF* |
⦗Top⦘ |