NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103700_100918

Scaffold Ga0103700_100918


Overview

Basic Information
Taxon OID3300008794 Open in IMG/M
Scaffold IDGa0103700_100918 Open in IMG/M
Source Dataset NameMicrobial communities from freshwater in the western basin of Lake Erie, USA - 882-1
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)827
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Source Dataset Sampling Location
Location Namewestern basin of Lake Erie, USA
CoordinatesLat. (o)41.76Long. (o)-83.31Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023279Metagenome / Metatranscriptome210N
F035195Metagenome / Metatranscriptome172N

Sequences

Protein IDFamilyRBSSequence
Ga0103700_1009181F035195N/ALKTEAEVVELVQDSLNNVETEKSFEDNYEVMLKLFCAIKRLKSIRPKGTFRAVGVSFKQASTPQK*
Ga0103700_1009182F023279N/AVTTEKMADSSKENTEAIVDTIKSELAIGFKNCIDKIDTEKKVVDRYNWEIYVKINKILHNSRRLDPQWTIEGDIGNSWSLNSILERDFKSKVLNIDLSEIDSIDLEGYEELHQSLKDLRVNNPGWSINKTRRSSPILLTPTQIGLQEESTS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.