Scaffold Ga0103698_101059

Overview

Basic Information

• Taxon OID: 3300008793
• Scaffold ID: Ga0103698_101059
• Source Dataset Name: Microbial communities from freshwater in the western basin of Lake Erie, USA - 1163-2
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1546
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: western basin of Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.46
  • Long. (^o): -82.71

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018650	Metagenome / Metatranscriptome	234	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103698_1010591	F018650	GGAG	LAEKYADWWTFKPSSPLKAYLSDREIVMDEYFSLEELRYRVMSILEHAAQFPNNSDVIVLEDQELQMVFDSWYIFVPDVVENHLLSHVIPAPADISNDLQNKHMIEDFFVYSPVDIIYKDPSSVFWIHPFVDFAMNQSTGNVGSWNKLLFMFTEFCLNNTTYFTRVSDSIIRINENTCLTSLFGFKYFHRSQIEHLLKKITKFLGRKNSMIQSCHFITHNPAFDITSIHPNVFTFIDDIINNNNDMMPDFQTGLYI*