Scaffold Ga0103698_101022

Overview

Basic Information

• Taxon OID: 3300008793
• Scaffold ID: Ga0103698_101022
• Source Dataset Name: Microbial communities from freshwater in the western basin of Lake Erie, USA - 1163-2
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1591
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: western basin of Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.46
  • Long. (^o): -82.71

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102145	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103698_1010223	F102145	N/A	MMVSYKIHVLKILAEKMATEKQEATETLLYNFDYPMVTECGAVKITDHHVFLQFPEKPTVHVEHAVKLRRNITLYVENGQCFSLDWIPIQTVTDFFRVKEMIEKCLQSYSYLLDNKTHFSPHTFSVNPINYYESLTTGFTTNSFSLSCFEHTVDTCIQLSVINKECDKKEIPLHFQL