 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300008788 Open in IMG/M |
| Scaffold ID | Ga0103688_1022493 Open in IMG/M |
| Source Dataset Name | Microbial communities of hydrothermal vent plumes from the Guaymas Basin in the Gulf of California - Plume GD6i |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 521 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent In Guaymas Basin In The Gulf Of California → Microbial Communities Of Hydrothermal Vent Plumes From The Guaymas Basin In The Gulf Of California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guaymas Basin in the Gulf of California | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052865 | Metagenome / Metatranscriptome | 142 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103688_10224931 | F052865 | N/A | KHMDLRGLGVVVLGLGLPSIATWMANSGVGSRVMSYVDMVPGMTTKYGKAVIAVGLTAGVSYLAAHFGAISAAEALTANMIAMGLVSVGLLKTMSLPVGQGLVDNLPAANFGGLAGSASYGYIGNYHEGVGAEMLPQPQSQQLFGVRANIF* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |