Scaffold Ga0103688_1006149

Overview

Basic Information

• Taxon OID: 3300008788
• Scaffold ID: Ga0103688_1006149
• Source Dataset Name: Microbial communities of hydrothermal vent plumes from the Guaymas Basin in the Gulf of California - Plume GD6i
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 932
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent In Guaymas Basin In The Gulf Of California → Microbial Communities Of Hydrothermal Vent Plumes From The Guaymas Basin In The Gulf Of California

Source Dataset Sampling Location

• Location Name: Guaymas Basin in the Gulf of California
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072408	Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103688_10061491	F072408	N/A	PAPADAYCPTQEDFGSDGGVTWHGNGWTIVGGGGVHSKTTWNLNGGYIEFEMDTSAAQGGVNNNLYTTSPDNVQPRNECDIQGQGKPSCMEMDILEMNGNCMAASTVHTWPNHNGGCDRGGCASSMKIGGKFHVKAEFSTGGWMTVTLNGQKNEHYQPSPSKNSQNFVVQTMNSKGAQIQSSQWVGWVPGASQCPGGGNLGASRFTVENLVVKGSVVQGPEPKKCGQMMNSSTVLV*