NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103638_1002835

Scaffold Ga0103638_1002835


Overview

Basic Information
Taxon OID3300008785 Open in IMG/M
Scaffold IDGa0103638_1002835 Open in IMG/M
Source Dataset NameMicrobial communities from wetland soil in Czech Republic - R1_cDNA
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterFriedrich Schiller University of Jena
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)590
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic

Source Dataset Sampling Location
Location NameCzech Republic
CoordinatesLat. (o)50.14667Long. (o)12.45083Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078329Metagenome / Metatranscriptome116Y
F091420Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0103638_10028351F078329AGGMSAPNRTEPQASFKALKRFSAKQKGVELRGRRLAVLIAEASTGHAGGERGWEADHLEPKK
Ga0103638_10028352F091420N/AEQSSRVERSGTGTMIRRLITKSERQAGSEGKSGGPRGELFSGTLN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.