Scaffold Ga0103637_1000218

Overview

Basic Information

• Taxon OID: 3300008784
• Scaffold ID: Ga0103637_1000218
• Source Dataset Name: Microbial communities from wetland soil in Czech Republic - M1_cDNA
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Friedrich Schiller University of Jena
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1703
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic

Source Dataset Sampling Location

• Location Name: Czech Republic
• Coordinates
  • Lat. (^o): 50.14667
  • Long. (^o): 12.45083

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092931	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103637_10002182	F092931	AGGAG	MPSSAEEKREIGSALMVIGWVLVLFAFLVMFFQPAAVKLGESRFQIIAAVLVLAGLALNIAGARVRTRNR*