Scaffold Ga0103594_10267

Overview

Basic Information

• Taxon OID: 3300008779
• Scaffold ID: Ga0103594_10267
• Source Dataset Name: Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 30m_>1.6micron
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 580
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates
  • Lat. (^o): 18.9
  • Long. (^o): -104.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065812	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103594_102671	F065812	GGA	MGDILLPRLNMDGKPIANKYCEGKVKRTLRRRLKDLKPLKRKV*