Basic Information | |
---|---|
IMG/M Taxon OID | 3300008779 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117950 | Gp0126183 | Ga0103594 |
Sample Name | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 30m_>1.6micron |
Sequencing Status | Permanent Draft |
Sequencing Center | Georgia Institute of Technology |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 704556 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus → Prochlorococcus marinus str. MIT 9201 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine oxygen minimum zone → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 18.9 | Long. (o) | -104.5 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000155 | Metagenome / Metatranscriptome | 1877 | Y |
F036277 | Metagenome / Metatranscriptome | 170 | Y |
F065812 | Metagenome / Metatranscriptome | 127 | Y |
F090440 | Metagenome / Metatranscriptome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0103594_10267 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 580 | Open in IMG/M |
Ga0103594_10334 | Not Available | 539 | Open in IMG/M |
Ga0103594_10382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus → Prochlorococcus marinus str. MIT 9201 | 515 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0103594_10267 | Ga0103594_102671 | F065812 | MGDILLPRLNMDGKPIANKYCEGKVKRTLRRRLKDLKPLKRKV* |
Ga0103594_10288 | Ga0103594_102881 | F000155 | LLLQMKFAAALIATVAANRYESMNEDDLLVNLESTLSSALSSEARGDADAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQP* |
Ga0103594_10334 | Ga0103594_103341 | F090440 | SLGGNEISGLKLATDLRLKRIYHCWNTDVGEGHDLRIISHKSIGG* |
Ga0103594_10382 | Ga0103594_103821 | F036277 | PGSNSPLCSNPFVDKSTQYELHSPNKNKIDLSYLGSASLDD* |
⦗Top⦘ |