Scaffold Ga0103619_101685

Overview

Basic Information

• Taxon OID: 3300008698
• Scaffold ID: Ga0103619_101685
• Source Dataset Name: Microbial communities of saline water collected from the North Sea in Germany - HE327_3b
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Goettingen Genomics Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 556
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany

Source Dataset Sampling Location

• Location Name: North Sea, Germany
• Coordinates
  • Lat. (^o): 54.4223
  • Long. (^o): 7.6833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017650	Metagenome / Metatranscriptome	239	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103619_1016851	F017650	N/A	INLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSAAETKEYLQTYFPRTWAHFDVNRSGSVEVIKMPQVMRFLASDQQMYLW*