NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017650

Metagenome / Metatranscriptome Family F017650

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017650
Family Type Metagenome / Metatranscriptome
Number of Sequences 239
Average Sequence Length 148 residues
Representative Sequence MKFFALAALTATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Number of Associated Samples 191
Number of Associated Scaffolds 239

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.84 %
% of genes near scaffold ends (potentially truncated) 78.66 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 178
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(32.636 % of family members)
Environment Ontology (ENVO) Unclassified
(66.109 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.029 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 28.28%    β-sheet: 15.17%    Coil/Unstructured: 56.55%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876011|none_p166071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300000116|DelMOSpr2010_c10165668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300003683|Ga0008459J53047_1013670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300004097|Ga0055584_100959953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium894Open in IMG/M
3300005838|Ga0008649_10215131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300006357|Ga0075502_1619512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300006382|Ga0075494_1023932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300006383|Ga0075504_1378798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300006390|Ga0075509_1489206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300006394|Ga0075492_1408550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300006400|Ga0075503_1003233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300006401|Ga0075506_1775700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300007558|Ga0102822_1066858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium848Open in IMG/M
3300007715|Ga0102827_1074842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300007955|Ga0105740_1094016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300007981|Ga0102904_1123563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300007981|Ga0102904_1178566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300008698|Ga0103619_101685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300008832|Ga0103951_10692190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300008930|Ga0103733_1055468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300008932|Ga0103735_1062216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300008934|Ga0103737_1036408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300008935|Ga0103738_1049641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300008936|Ga0103739_1043940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300008938|Ga0103741_1120245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300009003|Ga0102813_1105313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium898Open in IMG/M
3300009003|Ga0102813_1111675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium867Open in IMG/M
3300009003|Ga0102813_1199046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300009071|Ga0115566_10325268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium901Open in IMG/M
3300009195|Ga0103743_1066584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300009263|Ga0103872_1074050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300009402|Ga0103742_1038781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300009423|Ga0115548_1288294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300009432|Ga0115005_10571594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium904Open in IMG/M
3300009432|Ga0115005_10596861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium884Open in IMG/M
3300009441|Ga0115007_10441431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium855Open in IMG/M
3300009441|Ga0115007_10614934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium724Open in IMG/M
3300009441|Ga0115007_11237239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300009526|Ga0115004_10679668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300009543|Ga0115099_10898541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300009543|Ga0115099_10942026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300009599|Ga0115103_1133097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300009606|Ga0115102_10994800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300009677|Ga0115104_10574179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300009732|Ga0123373_155959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300009785|Ga0115001_10450529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300010987|Ga0138324_10673722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300012370|Ga0123369_1069107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300012413|Ga0138258_1043819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300012415|Ga0138263_1033597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300012415|Ga0138263_1634915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300012418|Ga0138261_1108926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300012419|Ga0138260_10226943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300012472|Ga0129328_1139772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300012518|Ga0129349_1127802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300012524|Ga0129331_1388483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300012767|Ga0138267_1074796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300012920|Ga0160423_10494364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium832Open in IMG/M
3300012935|Ga0138257_1375989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300013295|Ga0170791_10442714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300016703|Ga0182088_1248076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300016731|Ga0182094_1001507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300016766|Ga0182091_1198382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300016781|Ga0182063_1312998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300016797|Ga0182090_1017943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300017731|Ga0181416_1171769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300018515|Ga0192960_104771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300018515|Ga0192960_105045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300018515|Ga0192960_105065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018593|Ga0192844_1015823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300018622|Ga0188862_1027382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300018622|Ga0188862_1028798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300018647|Ga0192913_1034079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300018681|Ga0193206_1028063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300018681|Ga0193206_1032462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300018684|Ga0192983_1060556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300018692|Ga0192944_1044130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300018716|Ga0193324_1048087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018725|Ga0193517_1069497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018730|Ga0192967_1067947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300018730|Ga0192967_1068542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300018739|Ga0192974_1077892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300018787|Ga0193124_1074166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300018791|Ga0192950_1055292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300018806|Ga0192898_1092729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300018836|Ga0192870_1079508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300018871|Ga0192978_1089315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300018871|Ga0192978_1097662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300018874|Ga0192977_1114948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300018913|Ga0192868_10053070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018926|Ga0192989_10144029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300018928|Ga0193260_10131404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300018974|Ga0192873_10376659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300018977|Ga0193353_10198202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300018977|Ga0193353_10204086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018980|Ga0192961_10165363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300018980|Ga0192961_10168863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018980|Ga0192961_10173002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300018980|Ga0192961_10173003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300018980|Ga0192961_10228605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300018982|Ga0192947_10226832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300018982|Ga0192947_10235635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300018989|Ga0193030_10248536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300019010|Ga0193044_10206519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300019021|Ga0192982_10283087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300019021|Ga0192982_10289237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300019021|Ga0192982_10291042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300019021|Ga0192982_10292823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019021|Ga0192982_10294665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300019022|Ga0192951_10320941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300019025|Ga0193545_10101937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300019031|Ga0193516_10238511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300019031|Ga0193516_10277699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300019031|Ga0193516_10280754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300019032|Ga0192869_10327253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300019032|Ga0192869_10439127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300019036|Ga0192945_10235338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300019036|Ga0192945_10235365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300019045|Ga0193336_10500079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019048|Ga0192981_10292388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300019048|Ga0192981_10292389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300019048|Ga0192981_10292392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300019048|Ga0192981_10292402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300019050|Ga0192966_10285865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300019083|Ga0188854_1011329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300019084|Ga0193051_112489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300019084|Ga0193051_113499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300019097|Ga0193153_1027562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300019097|Ga0193153_1027633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019100|Ga0193045_1068877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300019116|Ga0193243_1042147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300019118|Ga0193157_1024152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300019123|Ga0192980_1078264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300019123|Ga0192980_1078265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300019123|Ga0192980_1078267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300019133|Ga0193089_1108284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300019133|Ga0193089_1113467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300019133|Ga0193089_1113995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300019149|Ga0188870_10129857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300019150|Ga0194244_10048871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300019153|Ga0192975_10280164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300019153|Ga0192975_10309964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300019214|Ga0180037_1166354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300019253|Ga0182064_1002822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300019261|Ga0182097_1037335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300019266|Ga0182061_1337301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300019272|Ga0182059_1780536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300019283|Ga0182058_1130341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300019283|Ga0182058_1509374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300020013|Ga0182086_1288601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300020165|Ga0206125_10226376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium719Open in IMG/M
3300020175|Ga0206124_10169616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium872Open in IMG/M
3300020182|Ga0206129_10195325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium901Open in IMG/M
3300020185|Ga0206131_10217934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium920Open in IMG/M
3300021342|Ga0206691_1864989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300021345|Ga0206688_10921913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300021345|Ga0206688_11070231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300021348|Ga0206695_1280736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300021348|Ga0206695_1337032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300021350|Ga0206692_1505380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300021359|Ga0206689_10308960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300021359|Ga0206689_10781260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300021359|Ga0206689_11154705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300021365|Ga0206123_10455292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300021869|Ga0063107_102769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300021874|Ga0063147_107152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300021887|Ga0063105_1006133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300021887|Ga0063105_1017127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300021889|Ga0063089_1021121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300021898|Ga0063097_1026186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300021899|Ga0063144_1014777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300021899|Ga0063144_1031059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300021905|Ga0063088_1000342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300021921|Ga0063870_1004507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300021922|Ga0063869_1005634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300021927|Ga0063103_1001050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300021932|Ga0063872_1002555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300021936|Ga0063092_1090526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300021941|Ga0063102_1002238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300021950|Ga0063101_1004725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300021954|Ga0063755_1053267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300021958|Ga0222718_10332720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium778Open in IMG/M
3300022367|Ga0210312_118644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300022369|Ga0210310_1035045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300023554|Ga0228692_103512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300023565|Ga0228688_120660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300023674|Ga0228697_123583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300023679|Ga0232113_1023888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300023694|Ga0228683_1033938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300023704|Ga0228684_1071175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
(restricted) 3300024252|Ga0233435_1225459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300024346|Ga0244775_11279690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300025570|Ga0208660_1061702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium901Open in IMG/M
3300025699|Ga0209715_1150786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium784Open in IMG/M
3300025809|Ga0209199_1282847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300026427|Ga0247556_1115985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300026448|Ga0247594_1091838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300026449|Ga0247593_1066659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300026449|Ga0247593_1103898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300026470|Ga0247599_1129801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300027190|Ga0208674_1056798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300027191|Ga0208021_1025453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium898Open in IMG/M
3300027757|Ga0208671_10293823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300027810|Ga0209302_10223235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium895Open in IMG/M
3300027849|Ga0209712_10293742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium920Open in IMG/M
3300027849|Ga0209712_10303194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium904Open in IMG/M
3300028128|Ga0228645_1154491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300028137|Ga0256412_1308247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300028233|Ga0256417_1191759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300028335|Ga0247566_1083952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300030653|Ga0307402_10753345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300030670|Ga0307401_10564504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300030671|Ga0307403_10723051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300030671|Ga0307403_10735853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300030702|Ga0307399_10570556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300030720|Ga0308139_1067155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300030721|Ga0308133_1055994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300030722|Ga0308137_1100858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300030780|Ga0073988_10009064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300030857|Ga0073981_11641820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300031062|Ga0073989_13377352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300031542|Ga0308149_1037089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300031557|Ga0308148_1036892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300031558|Ga0308147_1044639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300031579|Ga0308134_1156529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300031589|Ga0307996_1074342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium902Open in IMG/M
3300031602|Ga0307993_1071643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium874Open in IMG/M
3300031621|Ga0302114_10180597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium902Open in IMG/M
3300031674|Ga0307393_1128842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300031688|Ga0308011_10165590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300031709|Ga0307385_10411467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300031729|Ga0307391_10603312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300031742|Ga0307395_10414638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300032491|Ga0314675_10562233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300032492|Ga0314679_10559135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300032520|Ga0314667_10650912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300032521|Ga0314680_10814964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300032651|Ga0314685_10721789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300033572|Ga0307390_10912688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine32.64%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.34%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.28%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.44%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.02%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.60%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.18%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica3.35%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.93%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.09%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.09%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.67%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.67%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.42%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.42%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.42%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.42%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.42%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine0.42%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.42%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.42%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.42%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.42%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.42%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.42%
North SeaEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea0.42%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876011Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-3LG-Hyp-75mEnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008698Microbial communities of saline water collected from the North Sea in Germany - HE327_3bEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016797Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018593Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000600 (ERX1782171-ERR1712017)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018647Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000833 (ERX1782439-ERR1712057)EnvironmentalOpen in IMG/M
3300018681Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019083Metatranscriptome of marine microbial communities from Baltic Sea - GS680_3p0_dTEnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021936Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023554Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 71R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024252 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300026427Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027190Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028128Seawater microbial communities from Monterey Bay, California, United States - 57DEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_16607112236876011Marine EstuarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMATIRQI
DelMOSpr2010_1016566813300000116MarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0008459J53047_101367013300003683SeawaterNTKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0055584_10095995323300004097Pelagic MarineMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSAAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL*
Ga0008649_1021513113300005838MarineMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADGSDDIFMRSMIMNYAREGKNADVGTPNGVFTMTESQTRGASAEVLATHKKMSAAETKEYLNTYFPRTWAHFDVNKVGFIGVETMPMFVRFLASDQQMSL*
Ga0075502_161951213300006357AqueousIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0075494_102393213300006382AqueousTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0075504_137879813300006383AqueousKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0075509_148920613300006390AqueousATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0075492_140855013300006394AqueousTKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0075503_100323313300006400AqueousNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0075506_177570013300006401AqueousQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0102822_106685813300007558EstuarinePKPQNPIKMKNVNLKRKLNVLINNIYFILQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL*
Ga0102827_107484223300007715EstuarineASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGSVGVEVLPQFVRFLASDQQLSL*
Ga0105740_109401613300007955Estuary WaterVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL*
Ga0102904_112356313300007981EstuarineMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL*
Ga0102904_117856613300007981EstuarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKLSAAETKEYLNTYFPRTWAHFDVNKAGAVGVEVLPQFVR
Ga0103619_10168513300008698North SeaINLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSAAETKEYLQTYFPRTWAHFDVNRSGSVEVIKMPQVMRFLASDQQMYLW*
Ga0103951_1069219013300008832MarineHGEYLITTTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKLSGAALKTYLDTYFPRTWAHFDVNKQGFVGVEAMPMFVRFLASDQQMSL*
Ga0103733_105546813300008930Ice Edge, Mcmurdo Sound, AntarcticaMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL*
Ga0103735_106221613300008932Ice Edge, Mcmurdo Sound, AntarcticaFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL*
Ga0103737_103640813300008934Ice Edge, Mcmurdo Sound, AntarcticaLSPSSLTAAAIPIKAKNIKLKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL*
Ga0103738_104964113300008935Ice Edge, Mcmurdo Sound, AntarcticaKAKNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL*
Ga0103739_104394013300008936Ice Edge, Mcmurdo Sound, AntarcticaMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL*
Ga0103741_112024513300008938Ice Edge, Mcmurdo Sound, AntarcticaALIATASAVSIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL*
Ga0102813_110531323300009003EstuarineMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGSVGVEVLPQFVRFLASDQQLSL*
Ga0102813_111167513300009003EstuarineKPQNPIKMKNVNLKRKLNVLINNIYFILQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL*
Ga0102813_119904613300009003EstuarineMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0115566_1032526813300009071Pelagic MarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGAVKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0103743_106658413300009195Ice Edge, Mcmurdo Sound, AntarcticaGELDWEDSLVFFALALFATAAAVTIRGDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNVDGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL*
Ga0103872_107405013300009263Surface Ocean WaterAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQARGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFVRFLASDQQLSL*
Ga0103742_103878113300009402Ice Edge, Mcmurdo Sound, AntarcticaFFVLLVILNIYLFYKTMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL*
Ga0115548_128829413300009423Pelagic MarineMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVKFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSAAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFV
Ga0115005_1057159413300009432MarineMLNLKRKVNVLINNIYLFNKTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDDGSPNGSFTMTEAQTRGASAEVLATHKKMDAGATKEYLNTYFPRTFAHFDVNKQGAIGVEVMPQFVRFLASDQTLSL*
Ga0115005_1059686113300009432MarineMKFFALAIIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL*
Ga0115007_1044143113300009441MarineMKFFALLVATASAVAIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLSTYFPRTWAHFDVNKVGNVGVEVLPQFVRFLASDQQLSL*
Ga0115007_1061493413300009441MarineMKFFALAAIVATATAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL*
Ga0115007_1123723913300009441MarineMLNLKRKVNVLINNIYLFNKTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDDGSPNGSFTMTEAQTRGASAEVLATHKKMDAGATKEYLNTYFPRTFAHFDVNKQGAIGVEVMPQFVRFLASD
Ga0115004_1067966813300009526MarineMKFFALLVATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQYADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL*
Ga0115099_1089854113300009543MarineTKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL*
Ga0115099_1094202613300009543MarineKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL*
Ga0115103_113309723300009599MarineNLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGTSAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL*
Ga0115102_1099480013300009606MarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0115104_1057417913300009677MarineMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL*
Ga0123373_15595913300009732MarineMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0115001_1045052913300009785MarineTMKFFALAAIVATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL*
Ga0138324_1067372213300010987MarineFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGAIGVEVMPQFVRFLASDQQLSL*
Ga0123369_106910713300012370MarineFFPLIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0138258_104381913300012413Polar MarineSGNIYLFYKTMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL*
Ga0138263_103359713300012415Polar MarineYKTMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGSSAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL*
Ga0138263_163491513300012415Polar MarineNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL*
Ga0138261_110892613300012418Polar MarineKTMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL*
Ga0138260_1022694313300012419Polar MarineKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSIIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL*
Ga0129328_113977213300012472AqueousKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0129349_112780213300012518AqueousTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL*
Ga0129331_138848313300012524AqueousNTKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL*
Ga0138267_107479613300012767Polar MarineTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL*
Ga0160423_1049436413300012920Surface SeawaterMKFSVLLALAAVEAVKINGDNGYFFARDIGRGGLDTKYERVPPVRFSADSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFIGVEVMPQFVRFLASDQQLSL*
Ga0138257_137598913300012935Polar MarineFYKTMKFFALAALAATVSAINIRGDFFEARDNGTGPLEKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPSTWAHFDVNKVGNVGFEVMPQFVRFLASDQQLSL*
Ga0170791_1044271413300013295FreshwaterVSVKGIKISAEGPYFEAKEIGTGPFDKKYERVLPEHFSGDDDDSFMRSMIMNYADEGKNADGSPNGKFTLTEAATRAAAAEVLGTHKKLSGAALTDYLKTYFPRTWAHYDVNKEGRVGVEVLPMFMKFLASD*
Ga0182088_124807613300016703Salt MarshQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182094_100150713300016731Salt MarshKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFNMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182091_119838213300016766Salt MarshRNNIYFILQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182063_131299813300016781Salt MarshFIFYKTMKFFALASIAAVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQARGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFVRFLASDQQLSL
Ga0182090_101794313300016797Salt MarshFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0181416_117176913300017731SeawaterMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLS
Ga0192960_10477113300018515MarineMGNIYLFYYNKTMKFFALATLAAVASAVTLRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192960_10504513300018515MarineTWGIIFIYLINLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192960_10506513300018515MarineMGNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192844_101582313300018593MarineMKFFALIATAAAVQIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGTPNGVFTMTEAQTRAASAEVLGTHKKMAGPEVKEYLNTYFPRTWAHFDVNKAGFIGVEAMP
Ga0188862_102738213300018622Freshwater LakeYNKTMKFFALAALAAVANAVTIRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQFVRFLASDQQLSL
Ga0188862_102879813300018622Freshwater LakeNTKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTMSL
Ga0192913_103407913300018647MarineMKFFALIATVSAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0193206_102806313300018681MarineMGNNIYFILQTMKFFALIATAAAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGGEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0193206_103246213300018681MarineMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKLSGAALKTYLDTYFPRTWAHFDVNKQGFIGVEAMPMFVRFLASDQQMSL
Ga0192983_106055613300018684MarineASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192944_104413013300018692MarineMGNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDSAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0193324_104808713300018716MarineGSDDEDVQLGAEPEEEVDHSGEFFTAQDQGTGTLDKKYERVPPANFATGGDDIFMRSMIMQYADEGKNKDGSPNGAFTMTEGATRAAASEVLGTHKKLAGAELSTYMNTYFPRTWAHFDVNKGGRVGVEAMPSFMRFLASDQQMSLQ
Ga0193517_106949713300018725MarineMGNNIYFILQTMKFFALIATAAAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNHQGFVGVEVMPMFMRFLASDQQMSL
Ga0192967_106794713300018730MarineMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0192967_106854213300018730MarineMGNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192974_107789213300018739MarineKTMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0193124_107416613300018787MarineTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0192950_105529213300018791MarineMGIFIYLIKHKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0192898_109272913300018806MarineMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGSFTMTEAQTRGASAEVLGTHKKMDAGAVKEYLNTYFPRTWAHFDVNKVGAIGVEVMPQFVRFLASDQQLSL
Ga0192870_107950813300018836MarineKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGSFTMTEAQTRGASAEVLGTHKKMAAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192978_108931513300018871MarineKTMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAGEVKEYLNTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL
Ga0192978_109766213300018871MarineMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0192977_111494813300018874MarineHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192868_1005307013300018913MarineTWGIIFIYLIKQKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGSFTMTEAQTRGASAEVLGTHKKMDAGAVKEYLNTYFPRTWAHFDVNKVGAIGVEVMPQFVRFLASDQQLSL
Ga0192989_1014402913300018926MarineKTMKFFALATLAAVASAVTLRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGAVGVETLPQFVRFLASDQQLSL
Ga0193260_1013140413300018928MarineKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0192873_1037665913300018974MarineHGEYLFILLNKTMKFFALATIATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAGAVKEYLNTYFPRTWAHFDVNKVGAIGVEVMPQFVRFLASDQQLSL
Ga0193353_1019820213300018977MarineTWGIYIYFITKTMKFFALIASAAAVTIRGDDPPCAAGGFYEARDNGTGPLDKKYERVLPVQFADGSDDLFMRSMIMNYAREGKNPDCSPNGVFTMTEAQVRSAAAEVLGTHKKMDAPAVKEYLNTYFPRTWAHFDVNKAGAVGVETTP
Ga0193353_1020408613300018977MarineTWGIIFIYFINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLAAAEVKEYLNTYFPRTWAHFDVNKVGFIGVEVMPQFVRFLASDQQLSL
Ga0192961_1016536313300018980MarineMGNIYLFYYNKTMKFFALATLAAVASAVTLRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQFVRFLASDQQLSL
Ga0192961_1016886313300018980MarineINAEYMGNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQFVRFLASDQQLSL
Ga0192961_1017300213300018980MarineTWGIIFIYLINLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQFVRFLASDQQLSL
Ga0192961_1017300313300018980MarineTWGIIFIYLIKHKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQFVRFLASDQQLSL
Ga0192961_1022860513300018980MarineFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0192947_1022683213300018982MarineINAEYMGNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDSAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192947_1023563513300018982MarineINAEYMGNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0193030_1024853613300018989MarineTWGIFIYLIKQKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFIGVEVMPQFVRFLASDQQLSL
Ga0193044_1020651913300019010MarineHGEYLFILLNKTMKFFALATIATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAAAVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192982_1028308713300019021MarineMGNIYFNNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0192982_1028923713300019021MarineMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGSFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0192982_1029104213300019021MarineMGNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMAAGEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192982_1029282313300019021MarineMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0192982_1029466513300019021MarineMKFFALAAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMAAGEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192951_1032094113300019022MarineMGNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0193545_1010193713300019025MarineMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0193516_1023851113300019031MarineMKFFALIATAAAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNHQGFVGVEVMPMFMRFLASDQQMSL
Ga0193516_1027769913300019031MarineWIATAAAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMTGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPMFMRFLASDQQMSL
Ga0193516_1028075413300019031MarineGDDEDVQLNAEPAEEVDHSGEQFTAQDQGTGTLDKKYERVPPANFATGGDDIFMRSMIMQYADEGKNKDGSPNGVFTMTEGATRAAASEVLGTHKKMAGAELSTYMNTYFPRTWAHFDVNKAGRVGVEGMPSFMRFLASDQQMSLQG
Ga0192869_1032725313300019032MarineTWGIFIYFINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLAAAEVKEYLNTYFPRTWAHFDVNKVGAIGVEVMPQFVRFLASDQQLSL
Ga0192869_1043912713300019032MarineTWGDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGAIGVEVMPQFVRFLASDQQLSL
Ga0192945_1023533813300019036MarineMGNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0192945_1023536513300019036MarineMGNNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0193336_1050007913300019045MarineHGQWIKRRVHGEYLITTTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKLSGAALKTYLDTYFPRTWAHFDVNKQGFIGVEAMPMFVRFLASDQQMSL
Ga0192981_1029238813300019048MarineMGNNIYFNNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0192981_1029238913300019048MarineMGNNIYFNNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAGEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192981_1029239213300019048MarineMGNNIYFNNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0192981_1029240213300019048MarineMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGSFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0192966_1028586513300019050MarineMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0188854_101132913300019083Freshwater LakeLKTMKFFALAAIVATATAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADPSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEILATHKKMSAAETKEYLTTYFPRTWAHFDVNKEGAVGVEVLPQFVRFLASDQQLSL
Ga0193051_11248913300019084MarineKTMKFFALATLAAVASAVTLRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0193051_11349923300019084MarineKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDSAGVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0193153_102756213300019097MarineMKFFALAALTATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0193153_102763313300019097MarineTWGIFIYFINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0193045_106887713300019100MarineTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAAAVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0193243_104214713300019116MarineHGIFIYFINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMAAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0193157_102415213300019118MarineMGNIIFIYFINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDIFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGGEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFMRFLASDQQMSL
Ga0192980_107826413300019123MarineMGNIYFNNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0192980_107826513300019123MarineMGNIYFNNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAGEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0192980_107826713300019123MarineMGNIYFNNTQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0193089_110828413300019133MarineMGNNIYLFYYNKTMKFFALATLAAVASAVTLRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEILPQFVRFLASDQQLSL
Ga0193089_111346713300019133MarineTWGIIFIYLIKHKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEILPQFVRFLASDQQLSL
Ga0193089_111399513300019133MarineHMGNIYLFNKHKTMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEILPQFVRFLASDQQLSL
Ga0188870_1012985713300019149Freshwater LakeYYNKTMKFFALAALAAVANAVTIRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQFVRFLASDQQLSL
Ga0194244_1004887113300019150MarineMGIIFIYFINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0192975_1028016413300019153MarineKMKFFALAALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0192975_1030996413300019153MarineKMKFFALAALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAGEVKEYLNTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL
Ga0180037_116635413300019214EstuarineFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL
Ga0182064_100282213300019253Salt MarshAAAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182097_103733513300019261Salt MarshTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182061_133730113300019266Salt MarshLYDAFGAPNGFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182059_178053613300019272Salt MarshILQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182058_113034113300019283Salt MarshKFFALASIAAVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQARGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFVRFLASDQQLSL
Ga0182058_150937413300019283Salt MarshFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0182086_128860113300020013Salt MarshKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVEVMPQFMRFLASDQQMSL
Ga0206125_1022637613300020165SeawaterMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0206124_1016961623300020175SeawaterMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSAAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0206129_1019532513300020182SeawaterMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGAVKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0206131_1021793413300020185SeawaterMKFFALAALAAVANAVTIRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGAVKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0206691_186498913300021342SeawaterKRMKFFALIATVSAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDIFMRSMIMNYAREGKNDPDGAGTPNGVFTMTESQTRGAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVETMPMFMRFLASDQQMSL
Ga0206688_1092191313300021345SeawaterLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0206688_1107023113300021345SeawaterLQTMKFFALIATAAAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDLFMRSMIMNYAREGKTEDGAPNGNFTMTEAQTRSAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFIASDQQMSL
Ga0206695_128073613300021348SeawaterLAAAASVKNLSQLSGDFFEARDNGTGPLDKKYERVVPANFASGDDDLFMRSMIMNYASEGKTDDDASPPGAPNGSFTMTEAATRAASAEVLGTHKKLEGAALKDYLTTYFPRTWAHFDVNKSGRVGVETMPQFMRFLASDQQLTL
Ga0206695_133703213300021348SeawaterTKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0206692_150538023300021350SeawaterVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0206689_1030896013300021359SeawaterINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0206689_1078126013300021359SeawaterMKFCALIATTAAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDIFMRSMIMNYAREGKNADGAPNGEFTMTEAQTRSAAAEVLATHKKMSGAEVKEYLNTYFPRTWAHFDVNKQGFIGVEAEPQFMRFIASDQQMSL
Ga0206689_1115470513300021359SeawaterTKTMKFFALIAAVSAVTIRGDYFEARDNGTGPLDKKYERVLPVQFADGSDDIFMRSMIMNYAREGKNDPDGAGTPNGVFTMTESQTRGAAAEVLGTHKKMSGAEVKEYLNTYFPRTWAHFDVNK
Ga0206123_1045529213300021365SeawaterMKFFALAALAAVANAVTIRDEVDHSGEFFQARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQ
Ga0063107_10276913300021869MarineMKFFALLVATASAVAIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLSTYFPRTWAHFDVNKVGNVGVEVLPQFVRFLASDQQLSL
Ga0063147_10715213300021874MarineKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063105_100613313300021887MarineKTMKFFALAAIVATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063105_101712713300021887MarineKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDDGSPNGSFTMTEAQTRGASAEVLATHKKMDAGATKEYLNTYFPRTFAHFDVNKQGAIGVEVMPQFVRFLASDQTLSL
Ga0063089_102112113300021889MarineKTMKFFALAAIVATATAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL
Ga0063097_102618613300021898MarineTKTMKFFALAIIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063144_101477713300021899MarineTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0063144_103105913300021899MarineKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMAAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETMPQFVRFLASDQQLSL
Ga0063088_100034213300021905MarineKTMKFFALAAIVATATAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063870_100450713300021921MarineNTKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0063869_100563413300021922MarineKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0063103_100105013300021927MarineMKFFALAAIVATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063872_100255513300021932MarineLKTMKFFALAAIVATATAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063092_109052613300021936MarineKFFALAIIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063102_100223813300021941MarineMKFFALAAIVATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0063101_100472513300021950MarineNLKTMKFFALALVATASAVAIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLSTYFPRTWAHFDVNKVGNVGVEVLPQFVRFLASDQQLSL
Ga0063755_105326713300021954MarineQKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDDGSPNGSFTMTEAQTRGASAEVLATHKKMDAGATKEYLNTYFPRTFAHFDVNKQGAIGVEVMPQFVRFLASDQTLSL
Ga0222718_1033272013300021958Estuarine WaterMKFFALATLAAVANAVTIREEPPVDHSGEFFQARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNADGSPNGVFTMTEAQTRGASAEVLGTHKKLSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVETLPQFVRFLASDQQLSL
Ga0210312_11864413300022367EstuarineMKFFALAAIVATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0210310_103504513300022369EstuarineFALAAIVATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0228692_10351213300023554SeawaterKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0228688_12066013300023565SeawaterMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0228697_12358313300023674SeawaterQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL
Ga0232113_102388813300023679SeawaterKDTKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0228683_103393813300023694SeawaterNTKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0228684_107117513300023704SeawaterINTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
(restricted) Ga0233435_122545913300024252SeawaterMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADGSDDIFMRSMIMNYAREGKNADVGTPNGVFTMTESQTRGASAEVLATHKKMSAAETKEYLNTYFPRTWAHFDVNKVGFIGVETMPMFVRFLASDQQMSL
Ga0244775_1127969013300024346EstuarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGSVGVEVLPQFVRFLASDQQLSL
Ga0208660_106170213300025570AqueousMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0209715_115078613300025699Pelagic MarineFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0209199_128284713300025809Pelagic MarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQ
Ga0247556_111598513300026427SeawaterTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYESVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0247594_109183813300026448SeawaterFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0247593_106665923300026449SeawaterVKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLASDQQLSL
Ga0247593_110389813300026449SeawaterLQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL
Ga0247599_112980113300026470SeawaterKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL
Ga0208674_105679813300027190EstuarineATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL
Ga0208021_102545313300027191EstuarineMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGSVGVEVLPQFVRFLASDQQLSL
Ga0208671_1029382313300027757EstuarinePKPQNPIKMKNVNLKRKLNVLINNIYFILQTMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL
Ga0209302_1022323513300027810MarineMKFFALAAIVATATAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL
Ga0209712_1029374223300027849MarineMKFFALAIIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0209712_1030319413300027849MarineMLNLKRKVNVLINNIYLFNKTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNDDGSPNGSFTMTEAQTRGASAEVLATHKKMDAGATKEYLNTYFPRTFAHFDVNKQGAIGVEVMPQFVRFLASDQTLSL
Ga0228645_115449113300028128SeawaterMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKTGAVGVEVLPQFV
Ga0256412_130824713300028137SeawaterMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0256417_119175913300028233SeawaterMKFFALIATAAAVTIRGDFFEARDNGTGPLDKKYERVLPPQFADASDDLFMRSMIMNYAREGKNDPDGAGTPNGVFTMTEAQTRSAAAEVLGTHKKMSGAETKEYLNTYFPRTWAHFDVNKQGFVGVETMPQFMRFLASDQQLSL
Ga0247566_108395213300028335SeawaterNTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFVGVEVMPQFVRFLASDQQLSL
Ga0307402_1075334513300030653MarineQKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0307401_1056450413300030670MarineKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0307403_1072305113300030671MarineNTKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGSFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0307403_1073585313300030671MarineASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0307399_1057055613300030702MarineKKMKFFALAAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAGEVKEYLNTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL
Ga0308139_106715513300030720MarineNLKTMKFFALLVATASAVAIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0308133_105599413300030721MarineKFFALAAIVATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0308137_110085813300030722MarineTVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0073988_1000906413300030780MarineKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFIGVEVMPQFVRFLASDQQLSL
Ga0073981_1164182013300030857MarineKFQLIAALVAVSQAVTLKGDFFEARDDGTGPLDAKYERVVPAHFATGDDDLFMRSMIKTYASEGKTEKKEDGTGGEPNGVFTLSEASARAAAAEVLGTHKKLSGEALKTYLTTYFPRTWAHFDVNKSGRVGVEVMPQFMRFLASDQQLQLQ
Ga0073989_1337735213300031062MarineTKTMKFFALATLATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGFIGVEVMPQFVRFLASDQQLSL
Ga0308149_103708913300031542MarineATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0308148_103689213300031557MarineNLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL
Ga0308147_104463913300031558MarineNLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0308134_115652913300031579MarineFALLVATASAVAIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLATHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0307996_107434213300031589MarineMLNLKRKVNVLINNIYFNNTQKTMKFFALALFATAAAVTIRGDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNVDGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0307993_107164313300031602MarineMKFFALALIATASAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDSAGVKEYLNTYFPRTWAHFDVNHTGVVGVEVMPQFMRFIASDQTL
Ga0302114_1018059713300031621MarineMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0307393_112884213300031674MarineKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0308011_1016559013300031688MarineMKFFALAALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAGEVKEYLNTYFPRTWAHFDVNKVGAVGVEVLPQFVRFLASDQQLSL
Ga0307385_1041146713300031709MarineKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSGAETKEYLQTYFPRTWAHFDVNKVGFVGVEVLPQFVRFLASDQQLSL
Ga0307391_1060331213300031729MarineTMKFFALAALAATVSAINIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKVGNVGVEVMPQFVRFLASDQQLSL
Ga0307395_1041463813300031742MarineIHKKTMKFFALATILAVASAVTIRGDKDDHSGEFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNADGSPNGLFTMTEAQTRGASAEVLGTHKKMSAAEVKEYLNTYFPRTWAHFDVNKTGAVGVEVLPQFVRFLSSDQQLSL
Ga0314675_1056223313300032491SeawaterKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTMSL
Ga0314679_1055913513300032492SeawaterFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0314667_1065091213300032520SeawaterTKTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0314680_1081496413300032521SeawaterSAGAAGAGGFVKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0314685_1072178913300032651SeawaterTMKFFALAALTATVTAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGAAAEVLGTHKKMDAGATKEYLNTYFPRTWAHFDVNKAGFVGVEVMPQFVRFLASDQTLSL
Ga0307390_1091268813300033572MarineKTMKFFALAFAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADASDDLFMRSMIMNYAREGKNEDGSPNGSFTMTEAQTRGASAEVLATHKKMSAAETKEYLTTYFPRTWAHFDVNKAGAVGVEVLPQFVRFLASDQQLSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.