| Basic Information | |
|---|---|
| Taxon OID | 3300008652 Open in IMG/M |
| Scaffold ID | Ga0103624_100323 Open in IMG/M |
| Source Dataset Name | Microbial communities of saline water collected from the North Sea in Germany - HE327_15 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Goettingen Genomics Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 746 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Sea, Germany | |||||||
| Coordinates | Lat. (o) | 54.449 | Long. (o) | 8.22 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101275 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103624_1003232 | F101275 | GAG | MTRLLGIFKSLGCFLLLSDVEPFKYEYRIGLETLVVRTLNQWALHVGELTPARTLTLKCLAWGVWLQRLNLNRLAGVCLNGG |
| ⦗Top⦘ |