| Basic Information | |
|---|---|
| Taxon OID | 3300008587 Open in IMG/M |
| Scaffold ID | Ga0103774_102721 Open in IMG/M |
| Source Dataset Name | Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-AB-F-D |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Centre National de la Recherche Scientifique (CNRS) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 693 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Champs-sur-Marne, France | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040623 | Metagenome / Metatranscriptome | 161 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103774_1027212 | F040623 | GGAG | MKVRIAIEQIIDIEDAMSNDMYFDLYGPTDMSNDDKVDYLVARFVEDLNTLAINDEISNQVLVEYIED* |
| ⦗Top⦘ |