Scaffold Ga0103774_100604

Overview

Basic Information

• Taxon OID: 3300008587
• Scaffold ID: Ga0103774_100604
• Source Dataset Name: Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-AB-F-D
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Centre National de la Recherche Scientifique (CNRS)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1447
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France

Source Dataset Sampling Location

• Location Name: Champs-sur-Marne, France
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068418	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103774_1006042	F068418	GAG	MDTGIGDEVGLEFSDIDVKGTIESEGSGQGRDNLSDESVKIGVGGSFDIEVSSADIVDSFVVEHDSDVGVLEEGVGGEDGVVGFNDSG*