Scaffold Ga0103775_104487

Overview

Basic Information

• Taxon OID: 3300008572
• Scaffold ID: Ga0103775_104487
• Source Dataset Name: Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-AB-F-N
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Centre National de la Recherche Scientifique (CNRS)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 605
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetes incertae sedis → ac1 cluster → Actinobacteria bacterium BACL2 MAG-120820-bin50 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France

Source Dataset Sampling Location

• Location Name: Champs-sur-Marne, France
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042867	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103775_1044872	F042867	GGAG	MYGAVSDVAPRQVVTPLAVVHTGFALATVGAATSRDAASAVPATSVKERLNLKFLMSYLVILSLA