| Basic Information | |
|---|---|
| Taxon OID | 3300008570 Open in IMG/M |
| Scaffold ID | Ga0103778_104831 Open in IMG/M |
| Source Dataset Name | Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-MB-F-D |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Centre National de la Recherche Scientifique (CNRS) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 533 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Champs-sur-Marne, France | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100333 | Metagenome / Metatranscriptome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103778_1048311 | F100333 | N/A | QIGKMVYFTYKKLNICTVALLATVFAVLIAAMAVDWYSYKVEFSYTRVAASDSSLASSLYNYTQTNFDMFGQTVNTQGANTKIVRTVQQTYAQLGASNVNEQFKIQQAFVLIALLAAGLLFVAHTLYFFDGFRNKILFFVGITALRTILVIALLVVVASEIIAFLAFLGLSDKIASD |
| ⦗Top⦘ |