Scaffold Ga0111033_1233029

Overview

Basic Information

• Taxon OID: 3300008516
• Scaffold ID: Ga0111033_1233029
• Source Dataset Name: Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aarhus University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9485
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (73.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location

• Location Name: Aarhus Bay station M5
• Coordinates
  • Lat. (^o): 56.10555
  • Long. (^o): 10.463333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036104	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111033_12330295	F036104	N/A	LKEVIMGENGIPLSIGIIIAAAVLGAAFIAGMVLLAVLFA*