NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110934_1000325

Scaffold Ga0110934_1000325


Overview

Basic Information
Taxon OID3300008507 Open in IMG/M
Scaffold IDGa0110934_1000325 Open in IMG/M
Source Dataset NameWastewater microbial communities from the domestic sewers in Singapore - Site 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8473
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Domestic Sewers

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095393Metagenome105N

Sequences

Protein IDFamilyRBSSequence
Ga0110934_10003252F095393GGAGMNHKAEYEAIKKQIAECEQELKNRCIECSNFNKKKGECLKHGFVPVEFIYQKNDCLDYDLLPF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.