Scaffold Ga0110940_1132889

Overview

Basic Information

• Taxon OID: 3300008487
• Scaffold ID: Ga0110940_1132889
• Source Dataset Name: Wastewater microbial communities from the hospital sewers in Singapore - Hospital 4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 927
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.3
  • Long. (^o): 103.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062845	Metagenome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0110940_11328892	F062845	AGGGGG	MKKTPFILHEKFRSDNNEQRKEHFQKEFERYIVDGLLNAVPSRSCA*