Basic Information | |
---|---|
Taxon OID | 3300008487 Open in IMG/M |
Scaffold ID | Ga0110940_1079943 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from the hospital sewers in Singapore - Hospital 4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 724 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.3 | Long. (o) | 103.8 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074964 | Metagenome | 119 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0110940_10799431 | F074964 | N/A | MITKKNVNKLQNAVIKENASNLVGAVKLYNALFANGADLKAICKTLEIPAEYAVKVAALAKDKKRLVAVCSQMLPKVGDTFVKFSLYSKVYKDNKVDKEKGIETKTADWCAENVIYGGEYKPFGFSTGETLETKKSAKWLVKETDEYKATYVAVRIKSYSIRTIAKCVSEYLTHESNQQ* |
⦗Top⦘ |