NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110940_1071612

Scaffold Ga0110940_1071612


Overview

Basic Information
Taxon OID3300008487 Open in IMG/M
Scaffold IDGa0110940_1071612 Open in IMG/M
Source Dataset NameWastewater microbial communities from the hospital sewers in Singapore - Hospital 4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)782
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088920Metagenome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0110940_10716122F088920N/AILHLILHFSQKVAIFAPKRAILLIFVPTLFFAGLSVFSPQTSPKISGQTSLYQPWLSPYCLFKD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.