Scaffold Ga0110940_1031766

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0110940_1031766

Scaffold Ga0110940_1031766

Overview

Basic Information
Taxon OID	3300008487 Open in IMG/M
Scaffold ID	Ga0110940_1031766 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from the hospital sewers in Singapore - Hospital 4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1287
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3	Long. (^o)	103.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078822	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0110940_10317662	F078822	AGG	LSSTFFDIFLSFPNAFLKAFRPHAVRFPAAFLLVHRFYLAFEELLSCATAYL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.