NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115358_10003123

Scaffold Ga0115358_10003123


Overview

Basic Information
Taxon OID3300008468 Open in IMG/M
Scaffold IDGa0115358_10003123 Open in IMG/M
Source Dataset NameSea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2321
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)27.4Long. (o)-93.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013484Metagenome / Metatranscriptome271Y

Sequences

Protein IDFamilyRBSSequence
Ga0115358_100031231F013484GGAGGVNIQFDLSDCTLSTEDQAVXDAVNEFLALLPDDADPKPALRLAMVILEAADVAPQDDLALVAGFTQSRSLREYVQRLQEEGLSGLWDHPIPGRPAVTTQTPVEKALLRVILGTVIEEHILPDDGVLAQRVNQTLSEDRVPEAGRVTASMVETIRLRWDIQRPAVNQQLRVAQRSQVPQPDMARLGQTCAGGAFILAVLLVETGWLKLAHLLPMAAKYAVTSTQWLLTSIFAVIYGVRCAFHLDDVRDIGFALLTGRPRPLTHGTFQHLLRAIPAKDAEKFYQASAESEVQAAGEGTRRISLDGHNLPRWTRIVELVXGKIGNTGRILKAEEMVLAYDLDAHLWLGLRTYHGTKKLSKGLVEIARELLEHRGSLEGILRLFFDKGGYSGTIFLALSQESRVRFYVPAVRYANNVAQWEQLQEDDFDATPFTFDKHADWPVDQRPAYRLADTEMTLNVREGSKIVDTVTLRAVVLHDPQGEKPAERWPVVILTDDREIDARALLNEYGDHWGQETAHRIGKHDLYLDILPPGYVLKTQRDDQGELQREVTFDQTAFFLSGWLRCLVFNLMTRFAEEMGGEYTKMWAGTLLRKFIRRPATLYLVGKDLHVVFDPFPGQDELQPLLDKLNAKRTALPWLNNLVVQFSIAQDEPVHPLTEPEKRNRLXGDG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.