NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115335_128366

Scaffold Ga0115335_128366


Overview

Basic Information
Taxon OID3300008463 Open in IMG/M
Scaffold IDGa0115335_128366 Open in IMG/M
Source Dataset NameDeep sea sediment microbial communities from the Gulf of Mexico ? control with no oil added
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Texas, Austin
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1198
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Methylohalomonas → Methylohalomonas lacus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)28.0Long. (o)-88.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028812Metagenome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0115335_1283663F028812N/AMDPDLENVIRQALGDALAAGKDHLSQTELAVRAVQRARPDMTASDALVAVNLARRE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.