Scaffold Ga0115335_128366

Overview

Basic Information

• Taxon OID: 3300008463
• Scaffold ID: Ga0115335_128366
• Source Dataset Name: Deep sea sediment microbial communities from the Gulf of Mexico ? control with no oil added
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Texas, Austin
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1198
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Methylohalomonas → Methylohalomonas lacus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.0
  • Long. (^o): -88.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028812	Metagenome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115335_1283663	F028812	N/A	MDPDLENVIRQALGDALAAGKDHLSQTELAVRAVQRARPDMTASDALVAVNLARRE*