Basic Information | |
---|---|
Taxon OID | 3300008463 Open in IMG/M |
Scaffold ID | Ga0115335_128366 Open in IMG/M |
Source Dataset Name | Deep sea sediment microbial communities from the Gulf of Mexico ? control with no oil added |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Texas, Austin |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1198 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Methylohalomonas → Methylohalomonas lacus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 28.0 | Long. (o) | -88.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028812 | Metagenome | 190 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115335_1283663 | F028812 | N/A | MDPDLENVIRQALGDALAAGKDHLSQTELAVRAVQRARPDMTASDALVAVNLARRE* |
⦗Top⦘ |