Scaffold Ga0115335_111925

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115335_111925

Scaffold Ga0115335_111925

Overview

Basic Information
Taxon OID	3300008463 Open in IMG/M
Scaffold ID	Ga0115335_111925 Open in IMG/M
Source Dataset Name	Deep sea sediment microbial communities from the Gulf of Mexico ? control with no oil added
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1682
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	28.0	Long. (^o)	-88.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081360	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115335_1119251	F081360	GGAGG	MELLLLLAVVALGTIAWLLFRIDAKLQAIGHMIHDASKPEDQRQLTD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.