Scaffold Ga0115203_135573

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115203_135573

Scaffold Ga0115203_135573

Overview

Basic Information
Taxon OID	3300008460 Open in IMG/M
Scaffold ID	Ga0115203_135573 Open in IMG/M
Source Dataset Name	Microbial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1102
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location
Location Name	Onefour, Alberta, CA
Coordinates	Lat. (^o)	49.115537	Long. (^o)	-110.468757	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115203_1355731	F029983	N/A	MTLCCTVDYKCVTVMDGVKFELNYIILLYTKNDA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.