 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008460 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118459 | Gp0136465 | Ga0115203 |
| Sample Name | Microbial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Texas, Austin |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 79658169 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 3 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Onefour, Alberta, CA | |||||||
| Coordinates | Lat. (o) | 49.115537 | Long. (o) | -110.468757 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029983 | Metagenome | 186 | Y |
| F060091 | Metagenome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0115203_109826 | Not Available | 1334 | Open in IMG/M |
| Ga0115203_116023 | Not Available | 1236 | Open in IMG/M |
| Ga0115203_124318 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 1313 | Open in IMG/M |
| Ga0115203_135573 | Not Available | 1102 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0115203_109826 | Ga0115203_1098261 | F029983 | VGYKWGTLMDGVKFEFNDII*LYTKNVSERRPRFISLGYFILYLS* |
| Ga0115203_116023 | Ga0115203_1160231 | F029983 | MLLCCTVGYKWIHCLMDGITFEFNDIILCIKNDSVLRRFV |
| Ga0115203_124318 | Ga0115203_1243181 | F060091 | MDELHDLNYKLDLSTESDSDEEMNELLLLYSLSKRNKSIWKSAYMKKRKSHGEFILTSELTNKQFTNYFRLNRNQFNEVLSIVNDKIYSVGCNAQKPIDPDEKLAVFLR* |
| Ga0115203_135573 | Ga0115203_1355731 | F029983 | MTLCCTVDYKCVTVMDGVKFELNYIILLYTKNDA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |