Scaffold Ga0115359_10002405

Overview

Basic Information

• Taxon OID: 3300008340
• Scaffold ID: Ga0115359_10002405
• Source Dataset Name: Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4702
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.4
  • Long. (^o): -93.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038478	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115359_100024054	F038478	AGGAGG	VHKEIMIDKTLNETLQKKHPDFTGELIDFDFGPNKIQIQATIVKELLEIDEEKXTQAFEGLCQSFSEVCSRYHIKFDPIDLFILVDDELKRGTSTKFRDVNNGNLFAEISIPTKDFQMHEYWKYSFXHELGHSWFSIEFSPEDMEYGHEDLFIDLVVICTFRKILPSYKRVYQEVRKHRTYFLTQQSKRFIGKELYRQILQDPEAYLRDLQQKIDSAYT*