NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111491_1005968

Scaffold Ga0111491_1005968


Overview

Basic Information
Taxon OID3300008268 Open in IMG/M
Scaffold IDGa0111491_1005968 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit 1, subject 158499257 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5714
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068941Metagenome124N

Sequences

Protein IDFamilyRBSSequence
Ga0111491_10059688F068941N/AMKNNKGLIIGIIGLIIVMIGGTYAYYRWNSTSNINVSVKISGNTVTFVGGSNVTGTLTPVDSKEKGIKKDITVKANEAGSTMSLYMDLTTMPNELKEESFVYELYYNDSTLVKKGNFKAYNASSNASGITYASSGVTTLTLFTDRNVNTTTDKYTLYLWFNGKDFTNPDTMQNKTLSFDLYATGKNATLNG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.