NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100217_14037

Scaffold Ga0100217_14037


Overview

Basic Information
Taxon OID3300008158 Open in IMG/M
Scaffold IDGa0100217_14037 Open in IMG/M
Source Dataset NameMinidiscus trioculatus and Planctomycetes bacterium Co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4376
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location
Location NameUSA: Monterey Bay
CoordinatesLat. (o)36.746Long. (o)-122.026Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094948Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0100217_140371F094948AGGTGGMTAALVLDCHYNIVHVLSSPQTITTGVGVAICWADLEILAQSEARCRPTHGCKSATSTSTKVQQVFINLLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.