NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100218_11349

Scaffold Ga0100218_11349


Overview

Basic Information
Taxon OID3300008156 Open in IMG/M
Scaffold IDGa0100218_11349 Open in IMG/M
Source Dataset NameMinidiscus trioculatus Co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11026
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location
Location NameUSA: Monterey Bay
CoordinatesLat. (o)36.746Long. (o)-122.026Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094948Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0100218_1134910F094948AGGTGGMTAAWVPDCHYNIVHVLSSPQIITSGVGGAKCVADLEILAQSEARCRPTHGCKSATSNSIKVLQVFINLLGTQAMPI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.