Basic Information | |
---|---|
Taxon OID | 3300008156 Open in IMG/M |
Scaffold ID | Ga0100218_11349 Open in IMG/M |
Source Dataset Name | Minidiscus trioculatus Co-assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 11026 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Monterey Bay | |||||||
Coordinates | Lat. (o) | 36.746 | Long. (o) | -122.026 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094948 | Metagenome / Metatranscriptome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0100218_1134910 | F094948 | AGGTGG | MTAAWVPDCHYNIVHVLSSPQIITSGVGGAKCVADLEILAQSEARCRPTHGCKSATSNSIKVLQVFINLLGTQAMPI |
⦗Top⦘ |