Scaffold Ga0110933_1098992

Overview

Basic Information

• Taxon OID: 3300008071
• Scaffold ID: Ga0110933_1098992
• Source Dataset Name: Wastewater microbial communities from the domestic sewers in Singapore - Site 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1012
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Domestic Sewers

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.3
  • Long. (^o): 103.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080163	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0110933_10989921	F080163	N/A	MKTIKFLQESFETKERFQQEISFKYSYNRDTVESIDFRINQRNIRYFYEAMQNFENSLVNEFKEKKNNFCNAKQFLESINDFDKIIFVIITYMKTYFDFCKDYSKISLHVHLVQFDFTTSVLIQGFYNYSHKDLSFSTKLESKVLDSEIELLQEKLDLIREEICKLIGVDPNLEKQGHEDNYVFNLNIESDNQIGFLLQETEL*