NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110941_1018213

Scaffold Ga0110941_1018213


Overview

Basic Information
Taxon OID3300008067 Open in IMG/M
Scaffold IDGa0110941_1018213 Open in IMG/M
Source Dataset NameWastewater microbial communities from the hospital sewers in Singapore - Hospital 5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2496
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044555Metagenome / Metatranscriptome154N

Sequences

Protein IDFamilyRBSSequence
Ga0110941_10182133F044555N/AMKTTNPSSRITISQNGNQILTCKVYKEPNYILSMSNEEILELISGLDYIGNLPTVPDLGKPIEIQVSTTRQIPLEQNKEVQTKIKEIIYNNLYDTLIDELKDTISRFQAQYNIQEINPYLQDILQNPEDLVSLSQHHKR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.