Basic Information | |
---|---|
Taxon OID | 3300008065 Open in IMG/M |
Scaffold ID | Ga0110935_1078082 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from the domestic sewers in Singapore - Site 3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 653 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Domestic Sewers |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.3 | Long. (o) | 103.8 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058173 | Metagenome / Metatranscriptome | 135 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0110935_10780821 | F058173 | GAGG | MKMTYWLAIGVAVVVLVVAALMWGRYHPDPDVIGRLTDQIRLETIKQYDQRINELNIQLKTSQAAYIESQKRYDTIIKKIKELKDGKDAIKPPADSTELTARFNNL |
⦗Top⦘ |