Scaffold Ga0110935_1025784

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0110935_1025784

Scaffold Ga0110935_1025784

Overview

Basic Information
Taxon OID	3300008065 Open in IMG/M
Scaffold ID	Ga0110935_1025784 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from the domestic sewers in Singapore - Site 3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2848
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Domestic Sewers

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3	Long. (^o)	103.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003622	Metagenome / Metatranscriptome	476	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0110935_10257845	F003622	N/A	MRSYKNELEAIANDLLTQNAEAKGNENKPNYSNRDFMNATIIFQTALMDKMYDNQDYDGMSMDDRMKMAESCGLALRKLIHTYTGLDTHKIEEFL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.