Scaffold Ga0114372_1001908

Overview

Basic Information

• Taxon OID: 3300008062
• Scaffold ID: Ga0114372_1001908
• Source Dataset Name: Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - SG7
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: National Aeronautics and Space Administration (NASA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1213
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Shallow-Sea Hydrothermal Vent, Milos, Greece

Source Dataset Sampling Location

• Location Name: Milos, Greece
• Coordinates
  • Lat. (^o): 36.674869
  • Long. (^o): 24.520916
  • Depth (m): .01 to .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056621	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114372_10019081	F056621	AGG	MSNKEQLDFAKRVQKRIQEKHPHFRLIKRRDEIEKEFKAENDNRKS*