Basic Information | |
---|---|
Taxon OID | 3300007987 Open in IMG/M |
Scaffold ID | Ga0100379_10354754 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-03 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 705 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah | |||||||
Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088268 | Metagenome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0100379_103547542 | F088268 | AGGTGG | MPTSAEIVEYLASEGLLDIQPWHDAGAISATDPLTRSQFCAGLNESMESIAANLRARRARFGIPTGD* |
⦗Top⦘ |