NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105735_1078854

Scaffold Ga0105735_1078854


Overview

Basic Information
Taxon OID3300007860 Open in IMG/M
Scaffold IDGa0105735_1078854 Open in IMG/M
Source Dataset NameCoastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)678
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location
Location NameOregon, USA
CoordinatesLat. (o)46.234Long. (o)-123.9163Alt. (m)Depth (m)9.6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016961Metagenome / Metatranscriptome243N

Sequences

Protein IDFamilyRBSSequence
Ga0105735_10788542F016961AGGAMLDPMNTALTIMGMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.