NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016961

Metagenome / Metatranscriptome Family F016961

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016961
Family Type Metagenome / Metatranscriptome
Number of Sequences 243
Average Sequence Length 45 residues
Representative Sequence MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Number of Associated Samples 166
Number of Associated Scaffolds 243

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 59.67 %
% of genes near scaffold ends (potentially truncated) 33.33 %
% of genes from short scaffolds (< 2000 bps) 76.54 %
Associated GOLD sequencing projects 146
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.420 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(14.403 % of family members)
Environment Ontology (ENVO) Unclassified
(47.737 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(39.918 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 82.22%    β-sheet: 0.00%    Coil/Unstructured: 17.78%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 243 Family Scaffolds
PF00271Helicase_C 31.69
PF13604AAA_30 10.70
PF04851ResIII 9.47
PF12684DUF3799 4.12
PF13481AAA_25 1.65
PF14890Intein_splicing 0.82
PF02511Thy1 0.41
PF01555N6_N4_Mtase 0.41
PF08774VRR_NUC 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 243 Family Scaffolds
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.41
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.41
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.41
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.83 %
UnclassifiedrootN/A6.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10000366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar313544Open in IMG/M
3300001213|JGIcombinedJ13530_107603040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3602Open in IMG/M
3300002402|B570J29627_1023926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3505Open in IMG/M
3300002835|B570J40625_100083521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34101Open in IMG/M
3300002835|B570J40625_100242147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31892Open in IMG/M
3300003277|JGI25908J49247_10033531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1434Open in IMG/M
3300003413|JGI25922J50271_10003217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34689Open in IMG/M
3300003499|JGI25930J51415_1081670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3537Open in IMG/M
3300004481|Ga0069718_14826709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3713Open in IMG/M
3300005525|Ga0068877_10000364Not Available38956Open in IMG/M
3300005581|Ga0049081_10021350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32458Open in IMG/M
3300005581|Ga0049081_10311213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3541Open in IMG/M
3300005582|Ga0049080_10059515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31315Open in IMG/M
3300005662|Ga0078894_10930379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3752Open in IMG/M
3300005805|Ga0079957_1034439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33303Open in IMG/M
3300005805|Ga0079957_1247211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3830Open in IMG/M
3300005940|Ga0073913_10001331All Organisms → cellular organisms → Bacteria3579Open in IMG/M
3300005940|Ga0073913_10081813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3546Open in IMG/M
3300005943|Ga0073926_10028753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31036Open in IMG/M
3300005943|Ga0073926_10086423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3632Open in IMG/M
3300005955|Ga0073922_1016405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3875Open in IMG/M
3300006030|Ga0075470_10092091All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300006030|Ga0075470_10092446All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia908Open in IMG/M
3300006639|Ga0079301_1009012All Organisms → cellular organisms → Bacteria3792Open in IMG/M
3300006641|Ga0075471_10025461All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3458Open in IMG/M
3300006641|Ga0075471_10227066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3965Open in IMG/M
3300006641|Ga0075471_10382670All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300006641|Ga0075471_10634714Not Available522Open in IMG/M
3300006802|Ga0070749_10034702All Organisms → Viruses → Predicted Viral3124Open in IMG/M
3300006802|Ga0070749_10179373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31220Open in IMG/M
3300006802|Ga0070749_10581464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3605Open in IMG/M
3300006802|Ga0070749_10673799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3554Open in IMG/M
3300006802|Ga0070749_10676376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3553Open in IMG/M
3300006805|Ga0075464_10075696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31903Open in IMG/M
3300006920|Ga0070748_1059651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31501Open in IMG/M
3300007538|Ga0099851_1012460All Organisms → Viruses → Predicted Viral3478Open in IMG/M
3300007541|Ga0099848_1005001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36072Open in IMG/M
3300007541|Ga0099848_1049329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31700Open in IMG/M
3300007541|Ga0099848_1274937Not Available583Open in IMG/M
3300007542|Ga0099846_1011121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33555Open in IMG/M
3300007542|Ga0099846_1160463All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia805Open in IMG/M
3300007543|Ga0102853_1075040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3614Open in IMG/M
3300007559|Ga0102828_1064407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3864Open in IMG/M
3300007593|Ga0102918_1285611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3508Open in IMG/M
3300007606|Ga0102923_1172518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3673Open in IMG/M
3300007618|Ga0102896_1261873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3533Open in IMG/M
3300007642|Ga0102876_1094255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3814Open in IMG/M
3300007670|Ga0102862_1098079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3733Open in IMG/M
3300007735|Ga0104988_10906Not Available37936Open in IMG/M
3300007860|Ga0105735_1078854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3678Open in IMG/M
3300007972|Ga0105745_1009059Not Available2291Open in IMG/M
3300007972|Ga0105745_1146844All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia720Open in IMG/M
3300007974|Ga0105747_1016486All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1985Open in IMG/M
3300008107|Ga0114340_1016374All Organisms → Viruses → Predicted Viral3546Open in IMG/M
3300008107|Ga0114340_1110222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31084Open in IMG/M
3300008113|Ga0114346_1045558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32215Open in IMG/M
3300008117|Ga0114351_1227051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31537Open in IMG/M
3300008120|Ga0114355_1099431All Organisms → Viruses → Predicted Viral1148Open in IMG/M
3300008261|Ga0114336_1038245All Organisms → Viruses → Predicted Viral4567Open in IMG/M
3300008261|Ga0114336_1151155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31028Open in IMG/M
3300008264|Ga0114353_1085774All Organisms → Viruses → Predicted Viral1719Open in IMG/M
3300008266|Ga0114363_1230843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3539Open in IMG/M
3300008267|Ga0114364_1061398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31301Open in IMG/M
3300008450|Ga0114880_1044911All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1897Open in IMG/M
3300008450|Ga0114880_1090193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31205Open in IMG/M
3300008450|Ga0114880_1264159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3527Open in IMG/M
3300008996|Ga0102831_1018819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32371Open in IMG/M
3300009059|Ga0102830_1042648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31387Open in IMG/M
3300009079|Ga0102814_10021421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33721Open in IMG/M
3300009079|Ga0102814_10332345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3827Open in IMG/M
3300009085|Ga0105103_10018067All Organisms → Viruses → Predicted Viral3446Open in IMG/M
3300009155|Ga0114968_10005709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar39212Open in IMG/M
3300009158|Ga0114977_10428709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3733Open in IMG/M
3300009160|Ga0114981_10103715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31576Open in IMG/M
3300009161|Ga0114966_10347050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3883Open in IMG/M
3300009164|Ga0114975_10583011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3597Open in IMG/M
3300009165|Ga0105102_10382872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3744Open in IMG/M
3300009168|Ga0105104_10126864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31376Open in IMG/M
3300009181|Ga0114969_10179859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31310Open in IMG/M
3300009184|Ga0114976_10039612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32809Open in IMG/M
3300009184|Ga0114976_10665448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3524Open in IMG/M
3300010354|Ga0129333_10342255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31332Open in IMG/M
3300010354|Ga0129333_11353556Not Available587Open in IMG/M
3300010370|Ga0129336_10251699All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300010370|Ga0129336_10488029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3665Open in IMG/M
3300012017|Ga0153801_1027206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31013Open in IMG/M
3300012666|Ga0157498_1017963Not Available1107Open in IMG/M
3300013005|Ga0164292_10239956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31268Open in IMG/M
3300013005|Ga0164292_10561230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3742Open in IMG/M
3300013005|Ga0164292_10583054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3724Open in IMG/M
3300013005|Ga0164292_10732254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3629Open in IMG/M
3300014811|Ga0119960_1009867All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300015050|Ga0181338_1043111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3668Open in IMG/M
3300017716|Ga0181350_1097965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3725Open in IMG/M
3300017716|Ga0181350_1098408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3723Open in IMG/M
3300017722|Ga0181347_1036031All Organisms → Viruses → Predicted Viral1530Open in IMG/M
3300017722|Ga0181347_1042785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31385Open in IMG/M
3300017722|Ga0181347_1104079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3807Open in IMG/M
3300017747|Ga0181352_1019920All Organisms → Viruses → Predicted Viral2082Open in IMG/M
3300017747|Ga0181352_1049886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31220Open in IMG/M
3300017747|Ga0181352_1128128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3681Open in IMG/M
3300017754|Ga0181344_1115598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3774Open in IMG/M
3300017754|Ga0181344_1159726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3642Open in IMG/M
3300017766|Ga0181343_1051653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31209Open in IMG/M
3300017766|Ga0181343_1061693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31090Open in IMG/M
3300017766|Ga0181343_1137928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3682Open in IMG/M
3300017774|Ga0181358_1108282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3988Open in IMG/M
3300017784|Ga0181348_1280927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3564Open in IMG/M
3300017785|Ga0181355_1039741All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2018Open in IMG/M
3300017785|Ga0181355_1106314All Organisms → Viruses → Predicted Viral1157Open in IMG/M
3300017785|Ga0181355_1166310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3883Open in IMG/M
3300019784|Ga0181359_1012356All Organisms → cellular organisms → Bacteria3087Open in IMG/M
3300019784|Ga0181359_1032006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32034Open in IMG/M
3300019784|Ga0181359_1042179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31767Open in IMG/M
3300019784|Ga0181359_1057561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31492Open in IMG/M
3300020141|Ga0211732_1218834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31091Open in IMG/M
3300020151|Ga0211736_10247649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar313063Open in IMG/M
3300020172|Ga0211729_10153070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3572Open in IMG/M
3300020205|Ga0211731_11345566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3814Open in IMG/M
3300020498|Ga0208050_1000441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36723Open in IMG/M
3300020513|Ga0208090_1004586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32434Open in IMG/M
3300020548|Ga0208856_1004748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32810Open in IMG/M
3300020549|Ga0207942_1013494All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300020551|Ga0208360_1005204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32028Open in IMG/M
3300020555|Ga0208358_1010378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31798Open in IMG/M
3300020566|Ga0208222_1018931All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300020570|Ga0208465_1001407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35130Open in IMG/M
3300021312|Ga0210306_1160346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3500Open in IMG/M
3300021956|Ga0213922_1000092All Organisms → cellular organisms → Bacteria54049Open in IMG/M
3300021960|Ga0222715_10000878Not Available29727Open in IMG/M
3300021960|Ga0222715_10316719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3881Open in IMG/M
3300021961|Ga0222714_10004937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar312873Open in IMG/M
3300021961|Ga0222714_10053785All Organisms → Viruses → Predicted Viral2769Open in IMG/M
3300021961|Ga0222714_10068810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32355Open in IMG/M
3300021962|Ga0222713_10237602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31195Open in IMG/M
3300021962|Ga0222713_10429045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3807Open in IMG/M
3300021962|Ga0222713_10728454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3562Open in IMG/M
3300021963|Ga0222712_10276223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31063Open in IMG/M
3300022179|Ga0181353_1040830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31226Open in IMG/M
3300022190|Ga0181354_1062231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31240Open in IMG/M
3300022198|Ga0196905_1071040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3960Open in IMG/M
3300022200|Ga0196901_1268266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3524Open in IMG/M
3300022213|Ga0224500_10235688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3669Open in IMG/M
3300022407|Ga0181351_1173035All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300024346|Ga0244775_11360608Not Available547Open in IMG/M
3300024348|Ga0244776_10075833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32558Open in IMG/M
3300025585|Ga0208546_1022489All Organisms → Viruses → Predicted Viral1586Open in IMG/M
3300025585|Ga0208546_1037575All Organisms → Viruses → Predicted Viral1174Open in IMG/M
3300025646|Ga0208161_1009186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34220Open in IMG/M
3300025647|Ga0208160_1142450Not Available587Open in IMG/M
3300025655|Ga0208795_1082782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3886Open in IMG/M
3300025848|Ga0208005_1134025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3773Open in IMG/M
3300025872|Ga0208783_10309404Not Available627Open in IMG/M
3300025889|Ga0208644_1139681All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300025896|Ga0208916_10238010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3790Open in IMG/M
3300026931|Ga0209850_1022045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3522Open in IMG/M
3300027114|Ga0208009_1027273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31221Open in IMG/M
3300027213|Ga0208555_1011880All Organisms → Viruses → Predicted Viral1367Open in IMG/M
3300027393|Ga0209867_1057926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3584Open in IMG/M
3300027608|Ga0208974_1022793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31930Open in IMG/M
3300027656|Ga0209357_1093730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3860Open in IMG/M
3300027659|Ga0208975_1009349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33423Open in IMG/M
3300027733|Ga0209297_1020721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33131Open in IMG/M
3300027733|Ga0209297_1064152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31632Open in IMG/M
3300027733|Ga0209297_1090180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31325Open in IMG/M
3300027734|Ga0209087_1096400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31261Open in IMG/M
3300027746|Ga0209597_1398887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3502Open in IMG/M
3300027759|Ga0209296_1069257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31774Open in IMG/M
3300027797|Ga0209107_10005126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar37335Open in IMG/M
3300027806|Ga0209985_10000587Not Available38970Open in IMG/M
3300027808|Ga0209354_10227513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3752Open in IMG/M
3300027808|Ga0209354_10381150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3551Open in IMG/M
3300027940|Ga0209893_1000876All Organisms → cellular organisms → Bacteria2849Open in IMG/M
3300027969|Ga0209191_1003601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar39175Open in IMG/M
3300027972|Ga0209079_10102806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3976Open in IMG/M
3300027973|Ga0209298_10046550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32032Open in IMG/M
3300027974|Ga0209299_1021491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32897Open in IMG/M
3300028420|Ga0210366_10511878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3521Open in IMG/M
3300031707|Ga0315291_10419593All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1266Open in IMG/M
3300031707|Ga0315291_10572793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31030Open in IMG/M
3300031707|Ga0315291_10714393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3887Open in IMG/M
3300031746|Ga0315293_10187839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1706Open in IMG/M
3300031758|Ga0315907_10340589All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300031758|Ga0315907_11245466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3518Open in IMG/M
3300031784|Ga0315899_10002710Not Available19482Open in IMG/M
3300031784|Ga0315899_11691890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3520Open in IMG/M
3300031787|Ga0315900_10611641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3794Open in IMG/M
3300031787|Ga0315900_10837707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3628Open in IMG/M
3300031857|Ga0315909_10075333All Organisms → Viruses → Predicted Viral3002Open in IMG/M
3300031857|Ga0315909_10271623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31286Open in IMG/M
3300031857|Ga0315909_10438700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3922Open in IMG/M
3300031857|Ga0315909_10973838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3515Open in IMG/M
3300031873|Ga0315297_10790644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3791Open in IMG/M
3300031885|Ga0315285_10181526All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1705Open in IMG/M
3300031885|Ga0315285_10269304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31300Open in IMG/M
3300031885|Ga0315285_10620638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3712Open in IMG/M
3300031951|Ga0315904_10020100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38049Open in IMG/M
3300031951|Ga0315904_10322049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31438Open in IMG/M
3300031951|Ga0315904_10811887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3768Open in IMG/M
3300031951|Ga0315904_11219806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3576Open in IMG/M
3300031952|Ga0315294_10252037All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1722Open in IMG/M
3300031963|Ga0315901_10538631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3900Open in IMG/M
3300032050|Ga0315906_10649803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3857Open in IMG/M
3300032092|Ga0315905_10785284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3831Open in IMG/M
3300032093|Ga0315902_10943460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3657Open in IMG/M
3300032116|Ga0315903_10319994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31300Open in IMG/M
3300032116|Ga0315903_10419850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31082Open in IMG/M
3300032164|Ga0315283_11321873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3746Open in IMG/M
3300032173|Ga0315268_10309159All Organisms → Viruses → Predicted Viral1532Open in IMG/M
3300032256|Ga0315271_10185242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31657Open in IMG/M
3300033233|Ga0334722_10018822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35967Open in IMG/M
3300033418|Ga0316625_101332836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3668Open in IMG/M
3300033418|Ga0316625_101388113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3657Open in IMG/M
3300033980|Ga0334981_0079550All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300033981|Ga0334982_0008026All Organisms → cellular organisms → Bacteria6366Open in IMG/M
3300033981|Ga0334982_0077935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31780Open in IMG/M
3300033981|Ga0334982_0090222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31629Open in IMG/M
3300033995|Ga0335003_0348827Not Available649Open in IMG/M
3300033996|Ga0334979_0201088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31175Open in IMG/M
3300033996|Ga0334979_0331247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3857Open in IMG/M
3300033996|Ga0334979_0677174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3540Open in IMG/M
3300034012|Ga0334986_0081910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31969Open in IMG/M
3300034012|Ga0334986_0425434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3669Open in IMG/M
3300034061|Ga0334987_0499967Not Available741Open in IMG/M
3300034063|Ga0335000_0000057All Organisms → cellular organisms → Bacteria81639Open in IMG/M
3300034064|Ga0335001_0624066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3565Open in IMG/M
3300034068|Ga0334990_0307476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3861Open in IMG/M
3300034102|Ga0335029_0002150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar315723Open in IMG/M
3300034102|Ga0335029_0067153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32590Open in IMG/M
3300034102|Ga0335029_0191310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31366Open in IMG/M
3300034104|Ga0335031_0065229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32606Open in IMG/M
3300034104|Ga0335031_0126333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31785Open in IMG/M
3300034104|Ga0335031_0309899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31023Open in IMG/M
3300034106|Ga0335036_0233183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31256Open in IMG/M
3300034106|Ga0335036_0240517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31231Open in IMG/M
3300034109|Ga0335051_0261782All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300034117|Ga0335033_0100672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31670Open in IMG/M
3300034200|Ga0335065_0388448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3859Open in IMG/M
3300034280|Ga0334997_0114840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31805Open in IMG/M
3300034283|Ga0335007_0372767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3904Open in IMG/M
3300034284|Ga0335013_0157848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31537Open in IMG/M
3300034284|Ga0335013_0422671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3815Open in IMG/M
3300034284|Ga0335013_0755572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3548Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.99%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater8.23%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.17%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.35%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.12%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.29%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand3.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.47%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.06%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.65%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.65%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.23%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.23%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.41%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.41%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.41%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.41%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.41%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.41%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.41%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.41%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.41%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.82%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002402Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300005955Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007618Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020548Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020555Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021312Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026931Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027213Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027393Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028420Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_10000366103300000882Freshwater And MarineMHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
JGIcombinedJ13530_10760304013300001213WetlandMRDRMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
B570J29627_102392613300002402FreshwaterNTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL*
B570J40625_10008352153300002835FreshwaterMLDCMNTVITIVCMAVLMPLCVIAGVYVGHSLTIKSQNTKTNEQNNRSL*
B570J40625_10024214733300002835FreshwaterMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTKTNEQK*
JGI25908J49247_1003353123300003277Freshwater LakeMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL*
JGI25922J50271_1000321753300003413Freshwater LakeMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL*
JGI25930J51415_108167013300003499Freshwater LakeVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL*
Ga0069718_1482670923300004481SedimentMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
Ga0068877_10000364373300005525Freshwater LakeMRDNMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM*
Ga0049081_1002135023300005581Freshwater LenticMRDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
Ga0049081_1031121323300005581Freshwater LenticMNTALTSMGMAILLPLCVIAGSYVGHSLTIKSQQTNDKQNNRSL*
Ga0049080_1005951553300005582Freshwater LenticMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL*
Ga0078894_1093037933300005662Freshwater LakeCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL*
Ga0079957_103443933300005805LakeMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTINEQSNRNRM*
Ga0079957_124721123300005805LakeMNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM*
Ga0073913_1000133143300005940SandMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
Ga0073913_1008181313300005940SandGTWMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL*
Ga0073926_1002875323300005943SandMLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL*
Ga0073926_1008642333300005943SandWMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL*
Ga0073922_101640513300005955SandNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL*
Ga0075470_1009209123300006030AqueousMNTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL*
Ga0075470_1009244623300006030AqueousMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM*
Ga0079301_100901253300006639Deep SubsurfaceMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNLM*
Ga0075471_1002546163300006641AqueousMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQKNNNRL*
Ga0075471_1022706623300006641AqueousMSTALTIISMAVLMPLCVIAGIYVGHTLTILTIKSQQTTTNEQSNRNRM*
Ga0075471_1038267023300006641AqueousMSTALTIISMAALMPICVIAGIYVGHRITIKSQQTTNEQSNRNRM*
Ga0075471_1063471423300006641AqueousMNTALTIISMAVLMPLCVIAGIYVGHTLTIRSQQTTTNEQSNRNRM*
Ga0070749_1003470223300006802AqueousMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQNTKTNDKQNNRSL*
Ga0070749_1017937323300006802AqueousMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL*
Ga0070749_1058146423300006802AqueousMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQQTNDKQN
Ga0070749_1067379923300006802AqueousMSTALTIISLAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM*
Ga0070749_1067637623300006802AqueousMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM*
Ga0075464_1007569633300006805AqueousMLDPMNTALTIMGMAVLLPFCVIAGIYVGHSITIRSQQTKTNEQNNRSL*
Ga0070748_105965123300006920AqueousMNTVITIVCMAVMLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
Ga0099851_101246053300007538AqueousMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM*
Ga0099848_1005001153300007541AqueousMNTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM*
Ga0099848_104932923300007541AqueousMNTAITIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL*
Ga0099848_127493713300007541AqueousTIMGMAILLPLCVIAGIYVGHSLTIKSQQTKTNEQK*
Ga0099846_101112113300007542AqueousMSTALTIISMAVLIPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM*
Ga0099846_116046323300007542AqueousMSTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM*
Ga0102853_107504013300007543EstuarineMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
Ga0102828_106440723300007559EstuarineMNTVITIVCMAVLMPLCVIAGIYVDHSLTIKSQNTKTNEQNNRSL*
Ga0102918_128561113300007593EstuarineMNTALTIMGMAILLPFCVIAGIYVGHSITIKSQQTKTNEQNNRSL*
Ga0102923_117251813300007606EstuarineVLQGTWMRDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
Ga0102896_126187323300007618EstuarineMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTN
Ga0102876_109425523300007642EstuarineMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0102862_109807923300007670EstuarineMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL*
Ga0104988_10906233300007735FreshwaterMSTALTIISMAALMPICVIAGIYVGHTLTIKSQQTTNEQSNRNRM*
Ga0105735_107885423300007860Estuary WaterMLDPMNTALTIMGMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0105745_100905913300007972Estuary WaterMLNPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK*
Ga0105745_114684413300007972Estuary WaterMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0105747_101648613300007974Estuary WaterMKTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0114340_101637453300008107Freshwater, PlanktonMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQQNNRSL*
Ga0114340_111022223300008107Freshwater, PlanktonMNTVITIVCMAVLMPLCVIAGIYVGHSITIKSQNTKTNEQNNRSL*
Ga0114346_104555823300008113Freshwater, PlanktonMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM*
Ga0114351_122705123300008117Freshwater, PlanktonMLQGTWLLNPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
Ga0114355_109943123300008120Freshwater, PlanktonMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKITTNEQSNRNRM*
Ga0114336_103824523300008261Freshwater, PlanktonMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
Ga0114336_115115513300008261Freshwater, PlanktonLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
Ga0114353_108577413300008264Freshwater, PlanktonALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
Ga0114363_123084323300008266Freshwater, PlanktonMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDK
Ga0114364_106139813300008267Freshwater, PlanktonMSTALTIISMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
Ga0114880_104491113300008450Freshwater LakeMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTN
Ga0114880_109019323300008450Freshwater LakeMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQT
Ga0114880_126415923300008450Freshwater LakeMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTND
Ga0102831_101881973300008996EstuarineMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQNTKTNEQQNNRSL*
Ga0102830_104264833300009059EstuarineMLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQN
Ga0102814_1002142113300009079EstuarineMLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKS
Ga0102814_1033234523300009079EstuarineMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNE
Ga0105103_1001806753300009085Freshwater SedimentMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL*
Ga0114968_1000570913300009155Freshwater LakeMNTALTIMGMAVMLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
Ga0114977_1042870913300009158Freshwater LakeMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQTNETKTKNEL*
Ga0114981_1010371513300009160Freshwater LakeMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0114966_1034705023300009161Freshwater LakeMNTVITIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSV*
Ga0114975_1058301123300009164Freshwater LakeMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0105102_1038287223300009165Freshwater SedimentMLNRMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL*
Ga0105104_1012686423300009168Freshwater SedimentMSTALTIVSMAVLMPLCVIAGVYVGHSLTIKSQQTKTNEQNNRSL*
Ga0114969_1017985923300009181Freshwater LakeMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL*
Ga0114976_1003961213300009184Freshwater LakeMLDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0114976_1066544823300009184Freshwater LakeMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKT
Ga0129333_1034225523300010354Freshwater To Marine Saline GradientMSTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL*
Ga0129333_1135355623300010354Freshwater To Marine Saline GradientMNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM*
Ga0129336_1025169923300010370Freshwater To Marine Saline GradientMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQNNRSL*
Ga0129336_1048802933300010370Freshwater To Marine Saline GradientTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM*
Ga0153801_102720623300012017FreshwaterMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTK*
Ga0157498_101796313300012666Freshwater, Surface IceNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTK*
Ga0164292_1023995653300013005FreshwaterPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL*
Ga0164292_1056123013300013005FreshwaterGTWMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL*
Ga0164292_1058305423300013005FreshwaterMNTALTIMGMAVLLPLCVIAGIYVGHSHTIKSQQT
Ga0164292_1073225413300013005FreshwaterPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL*
Ga0119960_100986723300014811AquaticMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTKTK*
Ga0181338_104311113300015050Freshwater LakeVLQGTWMFDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL*
Ga0181350_109796533300017716Freshwater LakeLDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0181350_109840823300017716Freshwater LakeMRDSMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQT
Ga0181347_103603113300017722Freshwater LakeQMLQGTWLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0181347_104278513300017722Freshwater LakeAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL
Ga0181347_110407923300017722Freshwater LakeMRDHMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0181352_101992093300017747Freshwater LakeMSTALTIISMAALMPLCVIAGIYVGHRITIKSQQTTNEQSNRNRM
Ga0181352_104988613300017747Freshwater LakeNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSN
Ga0181352_112812813300017747Freshwater LakeMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNN
Ga0181344_111559823300017754Freshwater LakeMNTALTIIGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0181344_115972613300017754Freshwater LakeSMAAMMPLCVIAGIYVGHTLTIKSQQKTNEQSNRNRM
Ga0181343_105165323300017766Freshwater LakeMFDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0181343_106169353300017766Freshwater LakeVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL
Ga0181343_113792813300017766Freshwater LakeGALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKKNNRSL
Ga0181358_110828223300017774Freshwater LakeMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQSNRNRM
Ga0181348_128092723300017784Freshwater LakeMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0181355_103974133300017785Freshwater LakeMSIALTIISMAVLMPLCVIAGIYVGHTLTIKSQNT
Ga0181355_110631423300017785Freshwater LakeMPLRMSTALTIISMAALMPLCVIAGIYVGHTLTIRSQNTKTNEQSNRNRM
Ga0181355_116631023300017785Freshwater LakeMNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM
Ga0181359_101235643300019784Freshwater LakeMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL
Ga0181359_103200623300019784Freshwater LakeMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTK
Ga0181359_104217973300019784Freshwater LakeMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM
Ga0181359_105756113300019784Freshwater LakeMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIK
Ga0211732_121883423300020141FreshwaterMFDPMSTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTNENKPNNSRL
Ga0211736_1024764973300020151FreshwaterMFDPMSTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTNENKPNNSRM
Ga0211729_1015307023300020172FreshwaterMSTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTNENKPNNSRL
Ga0211731_1134556643300020205FreshwaterMFDPMSTALTIMGMAILLPFCVIAGIYVGHSLTIKSQQTKTNEQNNSRL
Ga0208050_100044163300020498FreshwaterMPLRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0208090_100458623300020513FreshwaterMLDCMNTVITIVCMAVLMPLCVIAGVYVGHSLTIKSQNTKTNEQNNRSL
Ga0208856_1004748103300020548FreshwaterMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0207942_101349413300020549FreshwaterMLNRMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL
Ga0208360_100520483300020551FreshwaterRMPLRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0208358_101037873300020555FreshwaterMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL
Ga0208222_101893123300020566FreshwaterMLYCMNTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0208465_100140753300020570FreshwaterMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTKTNEQK
Ga0210306_116034623300021312EstuarineMLDPMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL
Ga0213922_100009273300021956FreshwaterMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNNKTNEQNRNRM
Ga0222715_10000878223300021960Estuarine WaterMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0222715_1031671923300021960Estuarine WaterMSTALTIISMAALMPICVIAGIYVGHTLTIKSQQTTNEQSNRNRM
Ga0222714_10004937123300021961Estuarine WaterMNTALTIISMAVLMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL
Ga0222714_1005378553300021961Estuarine WaterMLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQQNNNRL
Ga0222714_1006881033300021961Estuarine WaterMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM
Ga0222713_1023760223300021962Estuarine WaterMSTAMTIISMAALMPLCVIAGIYVGHTLTIKSQNNKTNEQQQNRNRM
Ga0222713_1042904513300021962Estuarine WaterDRMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL
Ga0222713_1072845423300021962Estuarine WaterMPLCMSTALTIVSMAVLMPLCVIAGIYVGHTLTILTIKSQQTTTNEQSNRNRM
Ga0222712_1027622323300021963Estuarine WaterMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0181353_104083023300022179Freshwater LakeMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQQTKTNEQSNRNRM
Ga0181354_106223123300022190Freshwater LakeMHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK
Ga0196905_107104023300022198AqueousMSTALTIISMAVLMPLCVIAGIYVGHTLTILTIKSQQTTTNEQSNRNRM
Ga0196901_126826623300022200AqueousMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL
Ga0224500_1023568823300022213SedimentMNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQSNRNRM
Ga0181351_117303523300022407Freshwater LakeMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK
Ga0244775_1136060823300024346EstuarineMRDSMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0244776_1007583363300024348EstuarineMFDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0208546_102248923300025585AqueousMNTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL
Ga0208546_103757523300025585AqueousMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM
Ga0208161_100918673300025646AqueousMNTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM
Ga0208160_114245023300025647AqueousMSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQS
Ga0208795_108278223300025655AqueousMSTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM
Ga0208005_113402513300025848AqueousMNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNE
Ga0208783_1030940423300025872AqueousMNTALTIISMAVLMPLCVIAGIYVGHTLTIRSQQTTTNEQSNRNRM
Ga0208644_113968143300025889AqueousMSTALTIISLAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM
Ga0208916_1023801033300025896AqueousMLDPMNTALTIMGMAVLLPFCVIAGIYVGHSITIRSQQTKTNEQNNRSL
Ga0209850_102204513300026931SandNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL
Ga0208009_102727323300027114Deep SubsurfaceMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNLM
Ga0208555_101188063300027213EstuarineIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0209867_105792633300027393SandPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0208974_102279323300027608Freshwater LenticMRDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0209357_109373023300027656Freshwater LakeMNTVITIVCMAVLMPLCVIAGIYVAHSLTIKSQTNETKTKNEL
Ga0208975_100934963300027659Freshwater LenticMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0209297_102072133300027733Freshwater LakeMFDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTVRSQQTKTNEQNNRSL
Ga0209297_106415273300027733Freshwater LakeMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQTNETKTKNEL
Ga0209297_109018013300027733Freshwater LakeMLDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0209087_109640023300027734Freshwater LakeMLDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIRSQQTK
Ga0209597_139888733300027746Freshwater LakeGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0209296_106925723300027759Freshwater LakeMFDPMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0209107_1000512613300027797Freshwater And SedimentMHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0209985_10000587243300027806Freshwater LakeMRDNMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM
Ga0209354_1022751333300027808Freshwater LakeDPMNTVITIVCMAVLLPFCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0209354_1038115023300027808Freshwater LakeMNTALTIMGMAILLPFCVIAGIYVGHSLTIKSQQTKTK
Ga0209893_1000876103300027940SandMHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0209191_100360143300027969Freshwater LakeMLDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0209079_1010280633300027972Freshwater SedimentMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0209298_1004655013300027973Freshwater LakeGTWMHDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0209299_102149123300027974Freshwater LakeMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0210366_1051187823300028420EstuarineMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0315291_1041959313300031707SedimentMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNN
Ga0315291_1057279333300031707SedimentMLNPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0315291_1071439323300031707SedimentMRDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0315293_1018783913300031746SedimentMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRS
Ga0315907_1034058913300031758FreshwaterMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQ
Ga0315907_1124546623300031758FreshwaterMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM
Ga0315899_10002710253300031784FreshwaterMSTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTTNEQSNRNRM
Ga0315899_1169189013300031784FreshwaterMSTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL
Ga0315900_1061164123300031787FreshwaterMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNTR
Ga0315900_1083770723300031787FreshwaterMNTVLTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0315909_1007533313300031857FreshwaterMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKT
Ga0315909_1027162323300031857FreshwaterMNTALTIMGMAILLPLCVIAGIYVGHYLTIKSQQTNDKQNNRSL
Ga0315909_1043870023300031857FreshwaterMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSITIKSQNTKTNEQNNRSL
Ga0315909_1097383823300031857FreshwaterMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKITTNEQSNRNRM
Ga0315297_1079064423300031873SedimentMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0315285_1018152613300031885SedimentMNTVITIVCMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQ
Ga0315285_1026930423300031885SedimentMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQTNETKTKNEL
Ga0315285_1062063833300031885SedimentAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0315904_10020100193300031951FreshwaterMLDNMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM
Ga0315904_1032204973300031951FreshwaterQVLQGTRMPLRMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM
Ga0315904_1081188723300031951FreshwaterMRDHMNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM
Ga0315904_1121980623300031951FreshwaterMSTALTIISMAILLPLCVIAGIYVGHSLTIKSQQTND
Ga0315294_1025203713300031952SedimentMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQN
Ga0315901_1053863123300031963FreshwaterMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0315906_1064980323300032050FreshwaterMRDCMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL
Ga0315905_1078528443300032092FreshwaterTIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL
Ga0315902_1094346023300032093FreshwaterMPLRMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM
Ga0315903_1031999413300032116FreshwaterMRDRMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQN
Ga0315903_1041985013300032116FreshwaterTWMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL
Ga0315283_1132187333300032164SedimentMRDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0315268_1030915913300032173SedimentGTWMRDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL
Ga0315271_1018524223300032256SedimentMNTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0334722_10018822103300033233SedimentMHDPMNTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0316625_10133283613300033418SoilTIISMAALMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM
Ga0316625_10138811323300033418SoilMPLRMNTALTIISMAALMPLCVIAGIYVGHTLTIKSQNNKTNEQQQNHNRM
Ga0334981_0079550_1120_12693300033980FreshwaterMLNRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0334982_0008026_4281_44183300033981FreshwaterMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL
Ga0334982_0077935_702_8663300033981FreshwaterMLQGTWLLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0334982_0090222_1124_12733300033981FreshwaterMLYCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL
Ga0335003_0348827_193_3213300033995FreshwaterMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK
Ga0334979_0201088_37_2013300033996FreshwaterMLQGTWLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL
Ga0334979_0331247_415_5523300033996FreshwaterMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL
Ga0334979_0677174_427_5403300033996FreshwaterMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0334986_0081910_679_8163300034012FreshwaterMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM
Ga0334986_0425434_254_4033300034012FreshwaterMLDRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0334987_0499967_632_7393300034061FreshwaterALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTK
Ga0335000_0000057_221_3553300034063FreshwaterMSTALTIISMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0335001_0624066_418_5643300034064FreshwaterMLDCMNTVITIVCMAALMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL
Ga0334990_0307476_3_1313300034068FreshwaterMFDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNE
Ga0335029_0002150_14736_148853300034102FreshwaterMHDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL
Ga0335029_0067153_1467_16043300034102FreshwaterMNTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0335029_0191310_400_5433300034102FreshwaterMLDPMNTVITIVCMAVLMPLCVIAGIYVGHSITIKSQTNETKTKNEL
Ga0335031_0065229_2336_24703300034104FreshwaterMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0335031_0126333_498_6623300034104FreshwaterMLQGTWLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0335031_0309899_912_10223300034104FreshwaterGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0335036_0233183_1018_11703300034106FreshwaterMRDHMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM
Ga0335036_0240517_1_1113300034106FreshwaterTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTK
Ga0335051_0261782_96_2603300034109FreshwaterMLQGTWLLDPTNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQTNRSN
Ga0335033_0100672_1562_16693300034117FreshwaterMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKS
Ga0335065_0388448_1_1233300034200FreshwaterTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL
Ga0334997_0114840_739_8733300034280FreshwaterMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQTNRSN
Ga0335007_0372767_2_1123300034283FreshwaterMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL
Ga0335013_0157848_1430_15373300034284FreshwaterMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0335013_0422671_469_6333300034284FreshwaterMLQGTGLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL
Ga0335013_0755572_432_5483300034284FreshwaterIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.