Scaffold Ga0104935_148197

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104935_148197

Scaffold Ga0104935_148197

Overview

Basic Information
Taxon OID	3300007852 Open in IMG/M
Scaffold ID	Ga0104935_148197 Open in IMG/M
Source Dataset Name	Non-marine hypersaline water microbial communities of A?ana Salar, Pa?s Vasco, Spain - Cell Surgencia A?ana 2014
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	506
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Microbial Communities Of A??Ana Salar, Pa??S Vasco, Spain

Source Dataset Sampling Location
Location Name	A?ana Salar (Pa?s Vasco, Spain)
Coordinates	Lat. (^o)	42.80111387	Long. (^o)	-2.985507	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104935_1481971	F066493	GAGG	MSQREWHDGVVDVADELVKEHSAEGAIERLQSRRQSSNEQLQQRCTEAIAYIRREVLADE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.