3300007852: Non-marine hypersaline water microbial communities of A?ana Salar, Pa?s Vasco, Spain - Cell Surgencia A?ana 2014

Overview

Basic Information

• IMG/M Taxon OID: 3300007852
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118086 | Gp0127904 | Ga0104935
• Sample Name: Non-marine hypersaline water microbial communities of A?ana Salar, Pa?s Vasco, Spain - Cell Surgencia A?ana 2014
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Alicante
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 78816411
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Non-Marine Hypersaline Water Microbial Communities Of A??Ana Salar, Pa??S Vasco, Spain
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Microbial Communities Of A??Ana Salar, Pa??S Vasco, Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Hypersaline (saline)

Location Information

• Location: A?ana Salar (Pa?s Vasco, Spain)
• Coordinates
  • Lat. (^o): 42.80111387
  • Long. (^o): -2.985507
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003128	Metagenome	506	Y
F066493	Metagenome	126	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0104935_109528	All Organisms → Viruses → Predicted Viral	1541
Ga0104935_148197	Not Available	506

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0104935_109528	Ga0104935_1095282	F003128	MQVEIEVDPEDIVKKKADDRGRVTLGAEYAGKKVRVAVLEVVEE*
Ga0104935_148197	Ga0104935_1481971	F066493	MSQREWHDGVVDVADELVKEHSAEGAIERLQSRRQSSNEQLQQRCTEAIAYIRREVLADE