Scaffold Ga0104935_109528

Overview

Basic Information

• Taxon OID: 3300007852
• Scaffold ID: Ga0104935_109528
• Source Dataset Name: Non-marine hypersaline water microbial communities of A?ana Salar, Pa?s Vasco, Spain - Cell Surgencia A?ana 2014
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Alicante
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1541
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Microbial Communities Of A??Ana Salar, Pa??S Vasco, Spain

Source Dataset Sampling Location

• Location Name: A?ana Salar (Pa?s Vasco, Spain)
• Coordinates
  • Lat. (^o): 42.80111387
  • Long. (^o): -2.985507

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003128	Metagenome	506	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104935_1095282	F003128	GGAGG	MQVEIEVDPEDIVKKKADDRGRVTLGAEYAGKKVRVAVLEVVEE*