Scaffold Ga0105910_10166

Overview

Basic Information

• Taxon OID: 3300007842
• Scaffold ID: Ga0105910_10166
• Source Dataset Name: Human anterior nares microbial communities from NIH, USA - visit 2, subject 764447348 reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Respiratory System → Nasopharyngeal → Anterior Nares → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003406	Metagenome / Metatranscriptome	488	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105910_101661	F003406	N/A	EMNEAAEECQRAFGVICSFIGTRDLVQEHIAFRVWPLAEKWEMPQETIKEADEGGLIRLKYTFKFGDKFVEPDDDWLKSIENLNDELLGAYSKAEDTAMSAAFGGRKKKRLNRVFDAIGFVYPDYCYPIRRQKRKTTTSAKEETAAAPSEPEPKRKKIKALTYRPRY