NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007842

3300007842: Human anterior nares microbial communities from NIH, USA - visit 2, subject 764447348 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007842 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052881 | Ga0105910
Sample NameHuman anterior nares microbial communities from NIH, USA - visit 2, subject 764447348 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size836123
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea1
Not Available1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Respiratory System → Nasopharyngeal → Anterior Nares → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002471Metagenome / Metatranscriptome556Y
F003406Metagenome / Metatranscriptome488Y
F014592Metagenome / Metatranscriptome261Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105910_10004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea2236Open in IMG/M
Ga0105910_10094Not Available597Open in IMG/M
Ga0105910_10166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays503Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105910_10004Ga0105910_100041F002471FKREAKNLTSHKAPIPAKEKGKAPMASNVQKNHAFMYHDRRQTRNAYRSYNAYDDFYSHAMFASSSSYVHDRNVGRRNVVHNMPRRNVVNVPRKVNEPSTIYHALNASFAICRKDRKVIARKLGAKCKGDKTCIWVPKDICTNLVGPNISWVPKTQA*
Ga0105910_10094Ga0105910_100941F014592LKASFARIGAFSSEENFTRGNPEGPIEWIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEAALSFEDTKDPSAEASIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAVKSAEAEGQLGIN*
Ga0105910_10166Ga0105910_101661F003406EMNEAAEECQRAFGVICSFIGTRDLVQEHIAFRVWPLAEKWEMPQETIKEADEGGLIRLKYTFKFGDKFVEPDDDWLKSIENLNDELLGAYSKAEDTAMSAAFGGRKKKRLNRVFDAIGFVYPDYCYPIRRQKRKTTTSAKEETAAAPSEPEPKRKKIKALTYRPRY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.